RegulonDB RegulonDB 10.8: Amino acid Sequence
Qin prophage; DUF3950 domain-containing protein YnfO Amino Acid Sequence


Size: 77

Fasta

 

>Qin prophage; DUF3950 domain-containing protein YnfO E. coli K12. Version NC_000913.3 GI:556503834
MSTKNRTRRTTTRNIRFPNQMIEQINIALEQKGSGNFSAWVIEACRRRLCSEKRVSSEAN
KEKSDITELLRKQVRPD
              
                            

Download fasta file
RegulonDB