RegulonDB RegulonDB 10.10: Amino acid Sequence
DUF2766 domain-containing protein YecJ Amino Acid Sequence


Size: 83

Fasta

 

>DUF2766 domain-containing protein YecJ E. coli K12. Version NC_000913.3 GI:556503834
MSQPLNADQELVSDVVACQLVIKQILDVLDVIAPVEVREKMSSQLKNIDFTNHPAAADPV
TMRAIQKAIALIELKFTPQGESH
              
                            

Download fasta file
RegulonDB