RegulonDB RegulonDB 10.9: Amino acid Sequence
PF12843 family protein YpeB Amino Acid Sequence


Size: 72

Fasta

 

>PF12843 family protein YpeB E. coli K12. Version NC_000913.3 GI:556503834
MEKEQLIEIANTIMPFGKYKGRRLIDLPEEYLLWFARKDEFPAGKLGELMQITLLIKTEG
LTQLVQPLKRPL
              
                            

Download fasta file
RegulonDB