RegulonDB RegulonDB 10.9: Amino acid Sequence
putative lipoprotein YifL Amino Acid Sequence


Size: 67

Fasta

 

>putative lipoprotein YifL E. coli K12. Version NC_000913.3 GI:556503834
MKNVFKALTVLLTLFSLTGCGLKGPLYFPPADKNAPPPTKPVETQTQSTVPDKNDRATGD
GPSQVNY
              
                            

Download fasta file
RegulonDB