RegulonDB RegulonDB 10.8: Amino acid Sequence
DLP12 prophage; uncharacterized protein YlcH Amino Acid Sequence


Size: 33

Fasta

 

>DLP12 prophage; uncharacterized protein YlcH E. coli K12. Version NC_000913.3 GI:556503834
MRTYNPNSLLPSQMQKCTCNSLHLAFDLCGGEA
              
                            

Download fasta file
RegulonDB