RegulonDB RegulonDB 10.8: Amino acid Sequence
cell envelope stress response protein YqcG Amino Acid Sequence


Size: 46

Fasta

 

>cell envelope stress response protein YqcG E. coli K12. Version NC_000913.3 GI:556503834
MSEENKENGFNHVKTFTKIIFIFSVLVFNDNEYKITDAAVNLFIQI
              
                            

Download fasta file
RegulonDB