RegulonDB RegulonDB 10.8: Amino acid Sequence
putative UPF0401 protein YpjI Amino Acid Sequence


Size: 89

Fasta

 

>putative UPF0401 protein YpjI E. coli K12. Version NC_000913.3 GI:556503834
MSNSEGW*SF*QTLSGLPQWASADCVAGPLVSAGITDINIEDDQGIHVRLIVRDAEGRMV
GGHGTLNRTPVKVLTAISTGQASAPTPSP
              
                            

Download fasta file
RegulonDB