RegulonDB RegulonDB 10.8: Amino acid Sequence
rpoE leader peptide Amino Acid Sequence


Size: 51

Fasta

 

>rpoE leader peptide E. coli K12. Version NC_000913.3 GI:556503834
MIRLQHDKQKQMRYGTLQKRDTLTLCLLKLQLMEWRFDSAWKFGLGRLYLG
              
                            

Download fasta file
RegulonDB