RegulonDB RegulonDB 10.9: Gene Form
   

cpxR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cpxA cpxR yiiM cpxP CpxR CpxR CpxR TSS_4598 TSS_4598 TSS_4597 TSS_4597 TSS_4596 TSS_4596 cpxPp cpxPp cpxRp cpxRp TSS_4594 TSS_4594 cpxAp1 cpxAp1 TSS_4593 TSS_4593

Gene      
Name: cpxR    Texpresso search in the literature
Synonym(s): ECK3905, EG10020, b3912, yiiA
Genome position(nucleotides): 4104972 <-- 4105670 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.36
External database links:  
ASAP:
ABE-0012774
CGSC:
34166
ECHOBASE:
EB0019
ECOLIHUB:
cpxR
OU-MICROARRAY:
b3912
STRING:
511145.b3912
COLOMBOS: cpxR


Product      
Name: DNA-binding transcriptional dual regulator CpxR
Synonym(s): CpxR, CpxR response regulator, YiiA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 26.312
Isoelectric point: 5.372
Motif(s):
 
Type Positions Sequence
3 -> 115 KILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAIL
131 -> 230 SPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVS
4 -> 112 ILLVDDDRELTSLLKELLEMEGFNVIVAHDGEQALDLLDDSIDLLLLDVMMPKKNGIDTLKALRQTHQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIR
152 -> 228 GQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0007155 - cell adhesion
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:0010810 - regulation of cell-substrate adhesion
Evidence: [HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
[IPI] Inferred from physical interaction
Reference(s): [1] Batchelor E., et al., 2005
[2] Danese PN., et al., 1995
[3] Dong J., et al., 1993
[4] Dorel C., et al., 2006
[5] Hirakawa H., et al., 2005
[6] Pao GM., et al., 1995
[7] Parkinson JS. 1993
[8] Parkinson JS., et al., 1992
[9] Pogliano J., et al., 1997
[10] Stock JB., et al., 1990
External database links:  
DIP:
DIP-47991N
ECOCYC:
CPXR-MONOMER
ECOLIWIKI:
b3912
INTERPRO:
IPR001867
INTERPRO:
IPR039420
INTERPRO:
IPR036388
INTERPRO:
IPR011006
INTERPRO:
IPR001789
MODBASE:
P0AE88
PANTHER:
PTHR26402
PDB:
4UHK
PDB:
4UHS
PDB:
4UHT
PDB:
4UHJ
PFAM:
PF00486
PFAM:
PF00072
PRIDE:
P0AE88
PRODB:
PRO_000022326
PROSITE:
PS50110
PROSITE:
PS51755
REFSEQ:
NP_418348
SMART:
SM00862
SMART:
SM00448
SMR:
P0AE88
UNIPROT:
P0AE88


Operon      
Name: cpxRA         
Operon arrangement:
Transcription unit        Promoter
cpxRA
cpxRA


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4593 4104614 reverse nd [RS-EPT-CBR] [11]
  promoter cpxAp1 4105101 reverse Similarity to the consensus
Read more >
[ICWHO] [12]
  promoter TSS_4594 4105685 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_4596 4106222 forward nd [RS-EPT-CBR] [11]
  promoter TSS_4597 4106224 forward nd [RS-EPT-CBR] [11]
  promoter TSS_4598 4106290 forward nd [RS-EPT-CBR] [11]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Batchelor E., Walthers D., Kenney LJ., Goulian M., 2005, The Escherichia coli CpxA-CpxR envelope stress response system regulates expression of the porins ompF and ompC., J Bacteriol 187(16):5723-31

 [2] Danese PN., Snyder WB., Cosma CL., Davis LJ., Silhavy TJ., 1995, The Cpx two-component signal transduction pathway of Escherichia coli regulates transcription of the gene specifying the stress-inducible periplasmic protease, DegP., Genes Dev 9(4):387-98

 [3] Dong J., Iuchi S., Kwan HS., Lu Z., Lin EC., 1993, The deduced amino-acid sequence of the cloned cpxR gene suggests the protein is the cognate regulator for the membrane sensor, CpxA, in a two-component signal transduction system of Escherichia coli., Gene 136(1-2):227-30

 [4] Dorel C., Lejeune P., Rodrigue A., 2006, The Cpx system of Escherichia coli, a strategic signaling pathway for confronting adverse conditions and for settling biofilm communities?, Res Microbiol 157(4):306-14

 [5] Hirakawa H., Inazumi Y., Masaki T., Hirata T., Yamaguchi A., 2005, Indole induces the expression of multidrug exporter genes in Escherichia coli., Mol Microbiol 55(4):1113-26

 [6] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [7] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [8] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [9] Pogliano J., Lynch AS., Belin D., Lin EC., Beckwith J., 1997, Regulation of Escherichia coli cell envelope proteins involved in protein folding and degradation by the Cpx two-component system., Genes Dev 11(9):1169-82

 [10] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [11] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [12] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB