RegulonDB RegulonDB 10.9: Gene Form
   

amn gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

amn shiA yeeN PhoB TSS_2295 TSS_2295 TSS_2294 (cluster) TSS_2294 (cluster) TSS_2293 (cluster) TSS_2293 (cluster) TSS_2292 TSS_2292 TSS_2291 TSS_2291 TSS_2290 (cluster) TSS_2290 (cluster) yeeNp4 yeeNp4 yeeNp7 yeeNp7 TSS_2289 TSS_2289 amnp1 amnp1 TSS_2288 TSS_2288

Gene      
Name: amn    Texpresso search in the literature
Synonym(s): ECK1977, EG10039, b1982
Genome position(nucleotides): 2055061 --> 2056515 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.24
Reference(s): [1] Leung HB., et al., 1989
[2] Leung HB., et al., 1984
External database links:  
ASAP:
ABE-0006579
CGSC:
17764
ECHOBASE:
EB0037
ECOLIHUB:
amn
OU-MICROARRAY:
b1982
STRING:
511145.b1982
COLOMBOS: amn


Product      
Name: AMP nucleosidase
Synonym(s): Amn
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.995
Isoelectric point: 6.3
Motif(s):
 
Type Positions Sequence
311 -> 316 ESQAIG
300 -> 302 WLM
12 -> 167 QALDKLDALYEQSVVALRNAIGNYITSGELPDENARKQGLFVYPSLTVTWDGSTTNPPKTRAFGRFTHAGSYTTTITRPTLFRSYLNEQLTLLYQDYGAHISVQPSQHEIPYPYVIDGSELTLDRSMSAGLTRYFPTTELAQIGDETADGIYHPTE
266 -> 431 ITADGQGITLVNIGVGPSNAKTICDHLAVLRPDVWLMIGHCGGLRESQAIGDYVLAHAYLRDDHVLDAVLPPDIPIPSIAEVQRALYDATKLVSGRPGEEVKQRLRTGTVVTTDDRNWELRYSASALRFNLSRAVAIDMESATIAAQGYRFRVPYGTLLCVSDKPL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0008714 - AMP nucleosidase activity
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0009116 - nucleoside metabolic process
GO:0044209 - AMP salvage
GO:0046033 - AMP metabolic process
External database links:  
ECOCYC:
AMP-NUCLEOSID-MONOMER
ECOLIWIKI:
b1982
INTERPRO:
IPR037109
INTERPRO:
IPR018953
INTERPRO:
IPR035994
INTERPRO:
IPR000845
INTERPRO:
IPR011271
MODBASE:
P0AE12
PANTHER:
PTHR43691:SF6
PDB:
1T8W
PDB:
1T8Y
PDB:
1T8S
PDB:
1T8R
PFAM:
PF01048
PFAM:
PF10423
PRIDE:
P0AE12
PRODB:
PRO_000022094
REFSEQ:
NP_416489
SMR:
P0AE12
SWISSMODEL:
P0AE12
UNIPROT:
P0AE12


Operon      
Name: amn         
Operon arrangement:
Transcription unit        Promoter
amn


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2288 2054169 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2289 2055032 forward nd [RS-EPT-CBR] [3]
  promoter yeeNp7 2056754 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yeeNp4 2056792 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2290 (cluster) 2056797 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2291 2056817 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2292 2056826 forward nd [RS-EPT-CBR] [3]
  promoter TSS_2293 (cluster) 2056836 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2294 (cluster) 2056849 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_2295 2056852 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Leung HB., Kvalnes-Krick KL., Meyer SL., deRiel JK., Schramm VL., 1989, Structure and regulation of the AMP nucleosidase gene (amn) from Escherichia coli., Biochemistry 28(22):8726-33

 [2] Leung HB., Schramm VL., 1984, The structural gene for AMP nucleosidase. Mapping, cloning, and overproduction of the enzyme., J Biol Chem 259(11):6972-8

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB