RegulonDB RegulonDB 10.9: Gene Form
   

arcB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arcB yhcC elbB arcZ yhcC5\' mtgA ArcA arcBp arcBp TSS_3531 TSS_3531 TSS_3530 TSS_3530 arcZp arcZp TSS_3529 TSS_3529 mtgAp4 mtgAp4

Gene      
Name: arcB    Texpresso search in the literature
Synonym(s): ECK3200, EG10062, b3210
Genome position(nucleotides): 3350689 <-- 3353025 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.62
External database links:  
ASAP:
ABE-0010537
CGSC:
29063
ECHOBASE:
EB0060
ECOLIHUB:
arcB
OU-MICROARRAY:
b3210
STRING:
511145.b3210
COLOMBOS: arcB


Product      
Name: sensor histidine kinase ArcB
Synonym(s): ArcB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 87.983
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
527 -> 643 NVLLVEDIELNVIVARSVLEKLGNSVDVAMTGKAALEMFKPGEYDLVLLDIQLPDMTGLDISRELTKRYPREDLPPLVALTANVLKDKQEYLNAGMDDVLSKPLSVPALTAMIKKFW
576 -> 576 D
717 -> 717 H
58 -> 78 SIFFGLLITPWAVYFLSVVVE
289 -> 507 TISHELRTPLNGIVGLSRILLDTELTAEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVDFTSFLADLENLSALQAQQKGLRFNLEPTLPLPHQVITDGTRLRQILWNLISNAVKFTQQGQVTVRVRYDEGDMLHFEVEDSGIGIPQDELDKIFAMYYQVKDSHGGKPATGTGIGLAVSRRLAKNMGGDITVTSEQGKGSTFTLTIHAPS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006470 - protein dephosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
GO:0070482 - response to oxygen levels
Note(s): Note(s): ...[more].
Reference(s): [1] Alvarez AF., et al., 2010
[2] Cudic E., et al., 2017
[3] Georgellis D., et al., 1999
[4] Georgellis D., et al., 1997
[5] Ikegami T., et al., 2001
[6] Ishige K., et al., 1994
[7] Iuchi S., et al., 1992
[8] Jahn LJ., et al., 2017
[9] Kato M., et al., 1998
[10] Kato M., et al., 1999
[11] Kato M., et al., 1997
[12] Kato M., et al., 1999
[13] Kinoshita-Kikuta E., et al., 2016
[14] Kwon O., et al., 2000
[15] Maslennikov I., et al., 2010
[16] Matsubara M., et al., 2000
[17] Matsubara M., et al., 2000
[18] Matsushika A., et al., 1998
[19] Matsushika A., et al., 1998
[20] Ogino T., et al., 1998
[21] Oshima T., et al., 2002
[22] Pena-Sandoval GR., et al., 2010
[23] Pena-Sandoval GR., et al., 2005
[24] Portnoy VA., et al., 2010
[25] Teran-Melo JL., et al., 2018
[26] Tsuzuki M., et al., 1995
[27] Yaku H., et al., 1997
[28] Yamamoto K., et al., 2005
External database links:  
DIP:
DIP-47915N
ECOCYC:
ARCB-MONOMER
ECOLIWIKI:
b3210
INTERPRO:
IPR036097
INTERPRO:
IPR035965
INTERPRO:
IPR027460
INTERPRO:
IPR036641
INTERPRO:
IPR036890
INTERPRO:
IPR013767
INTERPRO:
IPR040642
INTERPRO:
IPR011006
INTERPRO:
IPR014409
INTERPRO:
IPR000014
INTERPRO:
IPR000700
INTERPRO:
IPR001789
INTERPRO:
IPR003594
INTERPRO:
IPR003661
INTERPRO:
IPR004358
INTERPRO:
IPR005467
INTERPRO:
IPR008207
MINT:
P0AEC3
MODBASE:
P0AEC3
PDB:
2A0B
PDB:
2KSD
PDB:
1FR0
PDB:
1BDJ
PDB:
1A0B
PFAM:
PF00072
PFAM:
PF00512
PFAM:
PF00989
PFAM:
PF02518
PFAM:
PF01627
PFAM:
PF18415
PRIDE:
P0AEC3
PRINTS:
PR00344
PRODB:
PRO_000022124
PROSITE:
PS50894
PROSITE:
PS50113
PROSITE:
PS50112
PROSITE:
PS50109
PROSITE:
PS50110
REFSEQ:
YP_026207
SMART:
SM00073
SMART:
SM00388
SMART:
SM00387
SMART:
SM00448
SMART:
SM00091
SMR:
P0AEC3
SWISSMODEL:
P0AEC3
UNIPROT:
P0AEC3


Operon      
Name: arcB         
Operon arrangement:
Transcription unit        Promoter
arcB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mtgAp4 3349831 reverse Similarity to the consensus
Read more >
[ICWHO] [29]
  promoter TSS_3529 3350497 reverse nd [RS-EPT-CBR] [30]
  promoter TSS_3530 3351027 reverse nd [RS-EPT-CBR] [30]
  promoter TSS_3531 3351916 reverse nd [RS-EPT-CBR] [30]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Alvarez AF., Georgellis D., 2010, In vitro and in vivo analysis of the ArcB/A redox signaling pathway., Methods Enzymol 471:205-28

 [2] Cudic E., Surmann K., Panasia G., Hammer E., Hunke S., 2017, The role of the two-component systems Cpx and Arc in protein alterations upon gentamicin treatment in Escherichia coli., BMC Microbiol 17(1):197

 [3] Georgellis D., Kwon O., Lin EC., 1999, Amplification of signaling activity of the arc two-component system of Escherichia coli by anaerobic metabolites. An in vitro study with different protein modules., J Biol Chem 274(50):35950-4

 [4] Georgellis D., Lynch AS., Lin EC., 1997, In vitro phosphorylation study of the arc two-component signal transduction system of Escherichia coli., J Bacteriol 179(17):5429-35

 [5] Ikegami T., Okada T., Ohki I., Hirayama J., Mizuno T., Shirakawa M., 2001, Solution structure and dynamic character of the histidine-containing phosphotransfer domain of anaerobic sensor kinase ArcB from Escherichia coli., Biochemistry 40(2):375-86

 [6] Ishige K., Nagasawa S., Tokishita S., Mizuno T., 1994, A novel device of bacterial signal transducers., EMBO J 13(21):5195-202

 [7] Iuchi S., Lin EC., 1992, Mutational analysis of signal transduction by ArcB, a membrane sensor protein responsible for anaerobic repression of operons involved in the central aerobic pathways in Escherichia coli., J Bacteriol 174(12):3972-80

 [8] Jahn LJ., Munck C., Ellabaan MMH., Sommer MOA., 2017, Adaptive Laboratory Evolution of Antibiotic Resistance Using Different Selection Regimes Lead to Similar Phenotypes and Genotypes., Front Microbiol 8:816

 [9] Kato M., Mizuno T., Hakoshima T., 1998, Crystallization of a complex between a novel C-terminal transmitter, HPt domain, of the anaerobic sensor kinase ArcB and the chemotaxis response regulator CheY., Acta Crystallogr D Biol Crystallogr 54(Pt 1):140-2

 [10] Kato M., Mizuno T., Shimizu T., Hakoshima T., 1999, Refined structure of the histidine-containing phosphotransfer (HPt) domain of the anaerobic sensor kinase ArcB from Escherichia coli at 1.57 A resolution., Acta Crystallogr D Biol Crystallogr 55(Pt 11):1842-9

 [11] Kato M., Mizuno T., Shimizu T., Hakoshima T., 1997, Insights into multistep phosphorelay from the crystal structure of the C-terminal HPt domain of ArcB., Cell 88(5):717-23

 [12] Kato M., Shimizu T., Mizuno T., Hakoshima T., 1999, Structure of the histidine-containing phosphotransfer (HPt) domain of the anaerobic sensor protein ArcB complexed with the chemotaxis response regulator CheY., Acta Crystallogr D Biol Crystallogr 55(Pt 7):1257-63

 [13] Kinoshita-Kikuta E., Kinoshita E., Eguchi Y., Koike T., 2016, Validation of Cis and Trans Modes in Multistep Phosphotransfer Signaling of Bacterial Tripartite Sensor Kinases by Using Phos-Tag SDS-PAGE., PLoS One 11(2):e0148294

 [14] Kwon O., Georgellis D., Lin EC., 2000, Phosphorelay as the sole physiological route of signal transmission by the arc two-component system of Escherichia coli., J Bacteriol 182(13):3858-62

 [15] Maslennikov I., Klammt C., Hwang E., Kefala G., Okamura M., Esquivies L., Mors K., Glaubitz C., Kwiatkowski W., Jeon YH., Choe S., 2010, Membrane domain structures of three classes of histidine kinase receptors by cell-free expression and rapid NMR analysis., Proc Natl Acad Sci U S A 107(24):10902-7

 [16] Matsubara M., Kitaoka SI., Takeda SI., Mizuno T., 2000, Tuning of the porin expression under anaerobic growth conditions by his-to-Asp cross-phosphorelay through both the EnvZ-osmosensor and ArcB-anaerosensor in Escherichia coli., Genes Cells 5(7):555-69

 [17] Matsubara M., Mizuno T., 2000, The SixA phospho-histidine phosphatase modulates the ArcB phosphorelay signal transduction in Escherichia coli., FEBS Lett 470(2):118-24

 [18] Matsushika A., Mizuno T., 1998, The structure and function of the histidine-containing phosphotransfer (HPt) signaling domain of the Escherichia coli ArcB sensor., J Biochem 124(2):440-5

 [19] Matsushika A., Mizuno T., 1998, Mutational analysis of the histidine-containing phosphotransfer (HPt) signaling domain of the ArcB sensor in Escherichia coli., Biosci Biotechnol Biochem 62(11):2236-8

 [20] Ogino T., Matsubara M., Kato N., Nakamura Y., Mizuno T., 1998, An Escherichia coli protein that exhibits phosphohistidine phosphatase activity towards the HPt domain of the ArcB sensor involved in the multistep His-Asp phosphorelay., Mol Microbiol 27(3):573-85

 [21] Oshima T., Aiba H., Masuda Y., Kanaya S., Sugiura M., Wanner BL., Mori H., Mizuno T., 2002, Transcriptome analysis of all two-component regulatory system mutants of Escherichia coli K-12., Mol Microbiol 46(1):281-91

 [22] Pena-Sandoval GR., Georgellis D., 2010, The ArcB sensor kinase of Escherichia coli autophosphorylates by an intramolecular reaction., J Bacteriol 192(6):1735-9

 [23] Pena-Sandoval GR., Kwon O., Georgellis D., 2005, Requirement of the receiver and phosphotransfer domains of ArcB for efficient dephosphorylation of phosphorylated ArcA in vivo., J Bacteriol 187(9):3267-72

 [24] Portnoy VA., Scott DA., Lewis NE., Tarasova Y., Osterman AL., Palsson BO., 2010, Deletion of genes encoding cytochrome oxidases and quinol monooxygenase blocks the aerobic-anaerobic shift in Escherichia coli K-12 MG1655., Appl Environ Microbiol 76(19):6529-40

 [25] Teran-Melo JL., Pena-Sandoval GR., Silva-Jimenez H., Rodriguez C., Alvarez AF., Georgellis D., 2018, Routes of phosphoryl group transfer during signal transmission and signal decay in the dimeric sensor histidine kinase ArcB., J Biol Chem 293(34):13214-13223

 [26] Tsuzuki M., Ishige K., Mizuno T., 1995, Phosphotransfer circuitry of the putative multi-signal transducer, ArcB, of Escherichia coli: in vitro studies with mutants., Mol Microbiol 18(5):953-62

 [27] Yaku H., Kato M., Hakoshima T., Tsuzuki M., Mizuno T., 1997, Interaction between the CheY response regulator and the histidine-containing phosphotransfer (HPt) domain of the ArcB sensory kinase in Escherichia coli., FEBS Lett 408(3):337-40

 [28] Yamamoto K., Hirao K., Oshima T., Aiba H., Utsumi R., Ishihama A., 2005, Functional characterization in vitro of all two-component signal transduction systems from Escherichia coli., J Biol Chem 280(2):1448-56

 [29] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [30] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB