RegulonDB RegulonDB 10.9: Gene Form
   

argA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recD argA amiC ArgR ArgR TSS_3127 TSS_3127 amiCp6 amiCp6 argAp argAp amiCp7 amiCp7 TSS_3126 TSS_3126

Gene      
Name: argA    Texpresso search in the literature
Synonym(s): Arg1, Arg2, ECK2814, EG10063, b2818
Genome position(nucleotides): 2949242 --> 2950573 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.55
External database links:  
ASAP:
ABE-0009245
CGSC:
1021
ECHOBASE:
EB0061
ECOLIHUB:
argA
NCBI-GENE:
947289
OU-MICROARRAY:
b2818
STRING:
511145.b2818
COLOMBOS: argA


Product      
Name: N-acetylglutamate synthase
Synonym(s): ArgA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.195
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
54 -> 54 S
15 -> 15 H
58 -> 58 R
19 -> 19 Y
336 -> 413 KFTIIQRDNTTIACAALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0103045 - methione N-acyltransferase activity
GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0004042 - acetyl-CoA:L-glutamate N-acetyltransferase activity
GO:0042802 - identical protein binding
GO:0004358 - glutamate N-acetyltransferase activity
biological_process GO:0006526 - arginine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
External database links:  
DIP:
DIP-48037N
ECOCYC:
N-ACETYLTRANSFER-MONOMER
ECOLIWIKI:
b2818
INTERPRO:
IPR016181
INTERPRO:
IPR036393
INTERPRO:
IPR033719
INTERPRO:
IPR010167
INTERPRO:
IPR001048
INTERPRO:
IPR000182
MODBASE:
P0A6C5
PANTHER:
PTHR30602
PFAM:
PF00696
PFAM:
PF00583
PRIDE:
P0A6C5
PRODB:
PRO_000022126
PROSITE:
PS51186
REFSEQ:
NP_417295
SMR:
P0A6C5
UNIPROT:
P0A6C5


Operon      
Name: argA         
Operon arrangement:
Transcription unit        Promoter
argA


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3126 2949064 reverse nd [RS-EPT-CBR] [1]
  promoter amiCp7 2949066 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter amiCp6 2949189 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3127 2951765 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB