RegulonDB RegulonDB 10.9: Gene Form
   

btuR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sohB rluB yciK btuR CRP CRP sohBp2 sohBp2 sohBp1 sohBp1 TSS_1708 TSS_1708 TSS_1707 TSS_1707 TSS_1706 TSS_1706 TSS_1705 TSS_1705 TSS_1704 (cluster) TSS_1704 (cluster)

Gene      
Name: btuR    Texpresso search in the literature
Synonym(s): ECK1264, EG10130, b1270, cobA
Genome position(nucleotides): 1327767 <-- 1328357 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.25
External database links:  
ASAP:
ABE-0004261
CGSC:
18493
ECHOBASE:
EB0128
ECOLIHUB:
btuR
OU-MICROARRAY:
b1270
STRING:
511145.b1270
COLOMBOS: btuR


Product      
Name: cobinamide/cobalamin adenosyltransferase
Synonym(s): BtuR, CobA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.999
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
36 -> 42 GNGKGKT
28 -> 196 RGIIIVFTGNGKGKTTAAFGTATRAVGHGKKVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWDTQNRESDTAACREVWQHAKRMLADSSLDMVLLDELTYMVAYDYLPLEEVVQALNERPHQQTVIITGRGCHRDILELADTVSELRPVKHAFDAGVKAQIGIDY
3 -> 21 DERYQQRQQRVKEKVDARV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.13 - cobalamin
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008817 - cob(I)yrinic acid a,c-diamide adenosyltransferase activity
biological_process GO:0006779 - porphyrin-containing compound biosynthetic process
GO:0009236 - cobalamin biosynthetic process
GO:0019250 - aerobic cobalamin biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Lawrence JG., et al., 1995
[2] Lundrigan MD., et al., 1989
External database links:  
ECOCYC:
COBALADENOSYLTRANS-MONOMER
ECOLIWIKI:
b1270
INTERPRO:
IPR027417
INTERPRO:
IPR025826
INTERPRO:
IPR003724
MODBASE:
P0A9H5
PFAM:
PF12557
PFAM:
PF02572
PRIDE:
P0A9H5
PRODB:
PRO_000022239
REFSEQ:
NP_415786
SMR:
P0A9H5
SWISSMODEL:
P0A9H5
UNIPROT:
P0A9H5


Operon      
Name: yciK-btuR         
Operon arrangement:
Transcription unit        Promoter
yciK-btuR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1704 (cluster) 1326918 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1705 1326921 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1706 1326973 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1707 1326992 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1708 1327047 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lawrence JG., Roth JR., 1995, The cobalamin (coenzyme B12) biosynthetic genes of Escherichia coli., J Bacteriol 177(22):6371-80

 [2] Lundrigan MD., Kadner RJ., 1989, Altered cobalamin metabolism in Escherichia coli btuR mutants affects btuB gene regulation., J Bacteriol 171(1):154-61

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB