RegulonDB RegulonDB 10.9: Gene Form
   

chbF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chbF chbR chbG chbGp5 chbGp5 chbGp4 chbGp4

Gene      
Name: chbF    Texpresso search in the literature
Synonym(s): ECK1732, EG10144, b1734, celF, ydjD
Genome position(nucleotides): 1817148 <-- 1818500 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.78
External database links:  
ASAP:
ABE-0005785
CGSC:
17734
ECHOBASE:
EB0142
ECOLIHUB:
chbF
OU-MICROARRAY:
b1734
STRING:
511145.b1734
COLOMBOS: chbF


Product      
Name: monoacetylchitobiose-6-phosphate hydrolase
Synonym(s): CelF, ChbF, YdjD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.512
Isoelectric point: 6.326
Motif(s):
 
Type Positions Sequence
2 -> 450 SQKLKVVTIGGGSSYTPELLEGFIKRYHELPVSELWLVDVEGGKPKLDIIFDLCQRMIDNAGVPMKLYKTLDRREALKDADFVTTQLRVGQLPARELDERIPLSHGYLGQETNGAGGLFKGLRTIPVIFDIVKDVEELCPNAWVINFTNPAGMVTEAVYRHTGFKRFIGVCNIPIGMKMFIRDVLMLKDSDDLSIDLFGLNHMVFIKDVLINGKSRFAELLDGVASGQLKASSVKNIFDLPFSEGLIRSLNLLPCSYLLYYFKQKEMLAIEMGEYYKGGARAQVVQKVEKQLFELYKNPELKVKPKELEQRGGAYYSDAACEVINAIYNDKQAEHYVNIPHHGQIDNIPADWAVEMTCKLGRDGATPHPRITHFDDKVMGLIHTIKGFEIAASNAALSGEFNDVLLALNLSPLVHSDRDAELLAREMILAHEKWLPNFADCIAELKKAH
5 -> 73 LKVVTIGGGSSYTPELLEGFIKRYHELPVSELWLVDVEGGKPKLDIIFDLCQRMIDNAGVPMKLYKTLD
6 -> 187 KVVTIGGGSSYTPELLEGFIKRYHELPVSELWLVDVEGGKPKLDIIFDLCQRMIDNAGVPMKLYKTLDRREALKDADFVTTQLRVGQLPARELDERIPLSHGYLGQETNGAGGLFKGLRTIPVIFDIVKDVEELCPNAWVINFTNPAGMVTEAVYRHTGFKRFIGVCNIPIGMKMFIRDVLM
199 -> 415 FGLNHMVFIKDVLINGKSRFAELLDGVASGQLKASSVKNIFDLPFSEGLIRSLNLLPCSYLLYYFKQKEMLAIEMGEYYKGGARAQVVQKVEKQLFELYKNPELKVKPKELEQRGGAYYSDAACEVINAIYNDKQAEHYVNIPHHGQIDNIPADWAVEMTCKLGRDGATPHPRITHFDDKVMGLIHTIKGFEIAASNAALSGEFNDVLLALNLSPLV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0103047 - methyl beta-D-glucoside 6-phosphate glucohydrolase activity
GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008706 - 6-phospho-beta-glucosidase activity
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0055114 - oxidation-reduction process
GO:0052777 - diacetylchitobiose catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Plumbridge J., et al., 2004
External database links:  
CAZY:
GH4
ECOCYC:
EG10144-MONOMER
ECOLIWIKI:
b1734
INTERPRO:
IPR019802
INTERPRO:
IPR036291
INTERPRO:
IPR022616
INTERPRO:
IPR015955
INTERPRO:
IPR001088
MODBASE:
P17411
PANTHER:
PTHR32092
PFAM:
PF02056
PFAM:
PF11975
PRIDE:
P17411
PRINTS:
PR00732
PRODB:
PRO_000022275
PROSITE:
PS01324
REFSEQ:
NP_416248
SMR:
P17411
SWISSMODEL:
P17411
UNIPROT:
P17411


Operon      
Name: chbBCARFG         
Operon arrangement:
Transcription unit        Promoter
chbBCARFG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, ChbR
Repressed by: NagC, ChbR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter chbGp4 1817242 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter chbGp5 1817312 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Plumbridge J., Pellegrini O., 2004, Expression of the chitobiose operon of Escherichia coli is regulated by three transcription factors: NagC, ChbR and CAP., Mol Microbiol 52(2):437-49

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB