RegulonDB RegulonDB 10.9: Gene Form
   

modC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

modC ybhA modB

Gene      
Name: modC    Texpresso search in the literature
Synonym(s): ECK0754, EG10152, b0765, chlD, narD
Genome position(nucleotides): 796554 --> 797612 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.54
External database links:  
ASAP:
ABE-0002605
CGSC:
920
ECHOBASE:
EB0150
ECOLIHUB:
modC
OU-MICROARRAY:
b0765
STRING:
511145.b0765
COLOMBOS: modC


Product      
Name: molybdate ABC transporter ATP binding subunit
Synonym(s): ChlD, ModC, NarD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 39.102
Isoelectric point: 8.975
Motif(s):
 
Type Positions Sequence
289 -> 352 QTSIRNVLRAKVVNSYDDNGQVEVELEVGGKTLWARISPWARDELAIKPGLWLYAQIKSVSITA
290 -> 350 TSIRNVLRAKVVNSYDDNGQVEVELEVGGKTLWARISPWARDELAIKPGLWLYAQIKSVSI
17 -> 156 INETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDAEKGICLTPEKRRVGYVFQDARLFPHYKVRGNLRYGMSKSMVDQFDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPL
269 -> 352 AALRIRIQASDVSLVLQPPQQTSIRNVLRAKVVNSYDDNGQVEVELEVGGKTLWARISPWARDELAIKPGLWLYAQIKSVSITA
244 -> 250 PHYAMTA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.4 - molybdenum
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015098 - molybdate ion transmembrane transporter activity
GO:0015412 - ATPase-coupled molybdate transmembrane transporter activity
GO:0042888 - molybdenum ion transmembrane transporter activity
biological_process GO:0000041 - transition metal ion transport
GO:0030001 - metal ion transport
GO:0015689 - molybdate ion transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
MODC-MONOMER
ECOLIWIKI:
b0765
INTERPRO:
IPR003593
INTERPRO:
IPR017871
INTERPRO:
IPR005116
INTERPRO:
IPR008995
INTERPRO:
IPR011868
INTERPRO:
IPR015852
INTERPRO:
IPR003439
INTERPRO:
IPR027417
INTERPRO:
IPR004606
MODBASE:
P09833
PFAM:
PF00005
PFAM:
PF03459
PRIDE:
P09833
PRODB:
PRO_000023269
PROSITE:
PS51866
PROSITE:
PS51241
PROSITE:
PS50893
PROSITE:
PS00211
REFSEQ:
NP_415286
SMART:
SM00382
SMR:
P09833
UNIPROT:
P09833


Operon      
Name: modABC         
Operon arrangement:
Transcription unit        Promoter
modABC
modABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: ModE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB