RegulonDB RegulonDB 10.9: Gene Form
   

cpsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cpsB cpsG wcaI gmm

Gene      
Name: cpsB    Texpresso search in the literature
Synonym(s): ECK2043, EG10161, b2049, manC, mni, rfbM
Genome position(nucleotides): 2123084 <-- 2124520 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.18
External database links:  
ASAP:
ABE-0006791
CGSC:
18460
ECHOBASE:
EB0159
ECOLIHUB:
cpsB
OU-MICROARRAY:
b2049
STRING:
511145.b2049
COLOMBOS: cpsB


Product      
Name: mannose-1-phosphate guanylyltransferase
Synonym(s): CpsB, ManC, Mni, RfbM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.016
Isoelectric point: 5.016
Motif(s):
 
Type Positions Sequence
323 -> 473 VGVKDLVVVQTKDAVLIADRNAVQDVKKVVEQIKADGRHEHRVHREVYRPWGKYDSIDAGDRYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTAKVTIDGDIKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFAD
325 -> 325 V
8 -> 295 PVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVICNEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAAKRHSPESDPLMLVLAADHVIADEDAFRAAVRNAMPYAEAGKLVTFGIVPDLPETGYGYIRRGEVSAGEQDMVAFEVAQFVEKPNLETAQAYVASGEYYWNSGMFLFRAGRYLEELKKYRPDILDACEKAMSAVDPDLNFIRVDEEAFLACPEESVDYAVMERTADAVVVPMDAGWSDVGSWSSLWEISAHTAE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.10 - sugar nucleotide biosynthesis, conversions
  5 - cell processes --> 5.5 - adaptations --> 5.5.5 - dessication
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0004475 - mannose-1-phosphate guanylyltransferase activity
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0005976 - polysaccharide metabolic process
GO:0009058 - biosynthetic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009242 - colanic acid biosynthetic process
GO:0006972 - hyperosmotic response
GO:0009298 - GDP-mannose biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MANNPGUANYLTRANGDP-MONOMER
ECOLIWIKI:
b2049
INTERPRO:
IPR029044
INTERPRO:
IPR014710
INTERPRO:
IPR001538
INTERPRO:
IPR005835
INTERPRO:
IPR006375
INTERPRO:
IPR011051
MODBASE:
P24174
PFAM:
PF00483
PFAM:
PF01050
PRIDE:
P24174
PRODB:
PRO_000023160
REFSEQ:
NP_416553
SMR:
P24174
UNIPROT:
P24174


Operon      
Name: wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC         
Operon arrangement:
Transcription unit        Promoter
wcaCDEF-gmd-fcl-gmm-wcaI-cpsBG-wcaJ-wzxC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB