RegulonDB RegulonDB 10.10: Gene Form
   

cysG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: cysG    Texpresso search in the literature
Synonym(s): ECK3356, EG10188, b3368
Genome position(nucleotides): 3497828 --> 3499201 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.66
Reference(s): [1] Peakman T., et al., 1990
[2] Tei H., et al., 1990
External database links:  
ASAP:
ABE-0011010
CGSC:
893
ECHOBASE:
EB0185
ECOLIHUB:
cysG
OU-MICROARRAY:
b3368
STRING:
511145.b3368
COLOMBOS: cysG


Product      
Name: siroheme synthase
Synonym(s): CysG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.951
Isoelectric point: 6.122
Motif(s):
 
Type Positions Sequence
150 -> 207 HLGQVAKYAGQLRGRVKQQFATMGERRRFWEKLFVNDRLAQSLANNDQKAITETTEQL
227 -> 227 D
248 -> 248 D
298 -> 298 R
301 -> 303 GGD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.12 - heme, porphyrine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0016829 - lyase activity
GO:0016491 - oxidoreductase activity
GO:0004325 - ferrochelatase activity
GO:0004851 - uroporphyrin-III C-methyltransferase activity
GO:0043115 - precorrin-2 dehydrogenase activity
GO:0051266 - sirohydrochlorin ferrochelatase activity
GO:0042803 - protein homodimerization activity
GO:0051287 - NAD binding
biological_process GO:0008152 - metabolic process
GO:0006779 - porphyrin-containing compound biosynthetic process
GO:0006970 - response to osmotic stress
GO:0009236 - cobalamin biosynthetic process
GO:0032259 - methylation
GO:0019354 - siroheme biosynthetic process
External database links:  
ECOCYC:
SIROHEMESYN-MONOMER
ECOLIWIKI:
b3368
INTERPRO:
IPR036291
INTERPRO:
IPR000878
INTERPRO:
IPR003043
INTERPRO:
IPR006366
INTERPRO:
IPR006367
INTERPRO:
IPR012409
INTERPRO:
IPR014776
INTERPRO:
IPR014777
INTERPRO:
IPR019478
INTERPRO:
IPR028281
INTERPRO:
IPR035996
INTERPRO:
IPR043152
INTERPRO:
IPR037115
MODBASE:
P0AEA8
PFAM:
PF13241
PFAM:
PF14824
PFAM:
PF10414
PFAM:
PF00590
PRIDE:
P0AEA8
PRODB:
PRO_000022378
PROSITE:
PS00840
PROSITE:
PS00839
REFSEQ:
NP_417827
SMR:
P0AEA8
SWISSMODEL:
P0AEA8
UNIPROT:
P0AEA8


Operon      
Name: nirBDC-cysG         
Operon arrangement:
Transcription unit        Promoter
nirBDC-cysG
cysG
cysG


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, NarP
Repressed by: CRP, H-NS, IHF, Cra, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhfLp5 3499311 forward nd [ICWHO] [3]
  promoter yhfLp7 3499413 forward nd [ICWHO] [3]
  promoter yhfLp8 3499433 forward nd [ICWHO] [3]
  promoter yhfLp4 3499438 forward nd [ICWHO] [3]



RegulonDB