RegulonDB RegulonDB 10.9: Gene Form
   

cysI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysJ cysI cysH queD IHF CysB terminator ygcNp3 ygcNp3 TSS_3054 TSS_3054 cysJp cysJp TSS_3053 TSS_3053 TSS_3052 TSS_3052 TSS_3051 (cluster) TSS_3051 (cluster) TSS_3050 TSS_3050 TSS_3049 TSS_3049 TSS_3048 (cluster) TSS_3048 (cluster) TSS_3047 TSS_3047 TSS_3046 (cluster) TSS_3046 (cluster) TSS_3045 TSS_3045 TSS_3044 TSS_3044

Gene      
Name: cysI    Texpresso search in the literature
Synonym(s): ECK2758, EG10190, b2763
Genome position(nucleotides): 2888387 <-- 2890099 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.04
External database links:  
ASAP:
ABE-0009061
CGSC:
891
ECHOBASE:
EB0187
ECOLIHUB:
cysI
OU-MICROARRAY:
b2763
STRING:
511145.b2763
COLOMBOS: cysI


Product      
Name: sulfite reductase, hemoprotein subunit
Synonym(s): beta; subunit, CysI, SiR-HP
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 63.998
Isoelectric point: 7.702
Motif(s):
 
Type Positions Sequence
2 -> 570 SEKHPGPLVVEGKLTDAERMKHESNYLRGTIAEDLNDGLTGGFKGDNFLLIRFHGMYQQDDRDIRAERAEQKLEPRHAMLLRCRLPGGVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLHSVGLDALATANDMNRNVLCTSNPYESQLHAEAYEWAKKISEHLLPRTRAYAEIWLDQEKVATTDEEPILGQTYLPRKFKTTVVIPPQNDIDLHANDMNFVAIAENGKLVGFNLLVGGGLSIEHGNKKTYARTASEFGYLPLEHTLAVAEAVVTTQRDWGNRTDRKNAKTKYTLERVGVETFKAEVERRAGIKFEPIRPYEFTGRGDRIGWVKGIDDNWHLTLFIENGRILDYPARPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKESGLMNAVTPQRENSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVSDEHIVMRVTGCPNGCGRAMLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKEREAGEGFGDFTVRAGIIRPVLDPARDLWD
81 -> 138 LLRCRLPGGVITTKQWQAIDKFAGENTIYGSIRLTNRQTFQFHGILKKNVKPVHQMLH
23 -> 23 H
355 -> 417 NWHLTLFIENGRILDYPARPLKTGLLEIAKIHKGDFRITANQNLIIAGVPESEKAKIEKIAKE
430 -> 546 NSMACVSFPTCPLAMAEAERFLPSFIDNIDNLMAKHGVSDEHIVMRVTGCPNGCGRAMLAEVGLVGKAPGRYNLHLGGNRIGTRIPRMYKENITEPEILASLDELIGRWAKEREAGE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0009337 - sulfite reductase complex (NADPH)
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0004783 - sulfite reductase (NADPH) activity
GO:0020037 - heme binding
GO:0050661 - NADP binding
GO:0016002 - sulfite reductase activity
GO:0050311 - sulfite reductase (ferredoxin) activity
biological_process GO:0000097 - sulfur amino acid biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0019344 - cysteine biosynthetic process
GO:0000103 - sulfate assimilation
GO:0055114 - oxidation-reduction process
GO:0070814 - hydrogen sulfide biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Hunt CL., et al., 1987
[2] Kaufman J., et al., 1993
[3] Kaufman J., et al., 1993
[4] Li C., et al., 1987
[5] Tei H., et al., 1990
External database links:  
DIP:
DIP-9380N
ECOCYC:
BETACOMP-MONOMER
ECOLIWIKI:
b2763
INTERPRO:
IPR005117
INTERPRO:
IPR006066
INTERPRO:
IPR006067
INTERPRO:
IPR011786
INTERPRO:
IPR036136
MODBASE:
P17846
PDB:
5AOP
PDB:
5GEP
PDB:
6C3M
PDB:
6C3X
PDB:
6C3Y
PDB:
6C3Z
PDB:
6GEP
PDB:
7GEP
PDB:
8GEP
PDB:
4HTR
PDB:
4GEP
PDB:
4G39
PDB:
4G38
PDB:
4AOP
PDB:
3GEO
PDB:
3AOP
PDB:
2GEP
PDB:
2AOP
PDB:
1AOP
PFAM:
PF03460
PFAM:
PF01077
PRIDE:
P17846
PRINTS:
PR00397
PRODB:
PRO_000022380
PROSITE:
PS00365
REFSEQ:
NP_417243
SMR:
P17846
UNIPROT:
P17846


Operon      
Name: cysJIH         
Operon arrangement:
Transcription unit        Promoter
cysJIH
cysH


Transcriptional Regulation      
Display Regulation             
Activated by: CysB, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3044 2888303 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_3045 2888316 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_3046 (cluster) 2888497 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter TSS_3047 2888501 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_3048 (cluster) 2889307 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter TSS_3049 2889320 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_3050 2890373 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_3051 (cluster) 2891032 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter TSS_3052 2891818 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_3053 2891963 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_3054 2892190 forward nd [RS-EPT-CBR] [6]
  promoter ygcNp3 2892572 forward Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hunt CL., Colless V., Smith MT., Molasky DO., Malo MS., Loughlin RE., 1987, Lambda transducing phage and clones carrying genes of the cysJIHDC gene cluster of Escherichia coli K12., J Gen Microbiol 133(10):2707-17

 [2] Kaufman J., Siegel LM., Spicer LD., 1993, Proton NMR of Escherichia coli sulfite reductase: studies of the heme protein subunit with added ligands., Biochemistry 32(34):8782-91

 [3] Kaufman J., Spicer LD., Siegel LM., 1993, Proton NMR of Escherichia coli sulfite reductase: the unligated hemeprotein subunit., Biochemistry 32(11):2853-67

 [4] Li C., Peck HD., Przybyla AE., 1987, Cloning of the 3'-phosphoadenylyl sulfate reductase and sulfite reductase genes from Escherichia coli K-12., Gene 53(2-3):227-34

 [5] Tei H., Murata K., Kimura A., 1990, Molecular cloning of the cys genes (cysC, cysD, cysH, cysI, cysJ, and cysG) responsible for cysteine biosynthesis in Escherichia coli K-12., Biotechnol Appl Biochem 12(2):212-6

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB