RegulonDB RegulonDB 10.9: Gene Form
   

eco gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mqo eco yojO ModE IscR FNR NarP NarL NarP NarL ecop7 ecop7 ecop5 ecop5 napFp3 napFp3

Gene      
Name: eco    Texpresso search in the literature
Synonym(s): ECK2201, EG10255, b2209, eti
Genome position(nucleotides): 2303905 --> 2304393 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.49
External database links:  
ASAP:
ABE-0007297
CGSC:
32630
ECHOBASE:
EB0251
ECOLIHUB:
eco
OU-MICROARRAY:
b2209
STRING:
511145.b2209
COLOMBOS: eco


Product      
Name: serine protease inhibitor ecotin
Synonym(s): Eco, Eti
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 18.192
Isoelectric point: 7.249
Motif(s):
 
Type Positions Sequence
30 -> 152 IAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKA
1 -> 20 MKTILPAVLFAAFATTSAWA
21 -> 162 AESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
GO:0030414 - peptidase inhibitor activity
GO:0004867 - serine-type endopeptidase inhibitor activity
GO:0042803 - protein homodimerization activity
biological_process GO:0010466 - negative regulation of peptidase activity
GO:0010951 - negative regulation of endopeptidase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Brown KC., et al., 1998
[2] Corey DR., et al., 1993
[3] Erpel T., et al., 1992
[4] Lengyel Z., et al., 1998
External database links:  
ECOCYC:
EG10255-MONOMER
ECOLIWIKI:
b2209
INTERPRO:
IPR005658
INTERPRO:
IPR036198
INTERPRO:
IPR027438
INTERPRO:
IPR023084
MINT:
P23827
MODBASE:
P23827
PANTHER:
PTHR35890
PDB:
1FI8
PDB:
4NIY
PDB:
4IW4
PDB:
1XXF
PDB:
1XXD
PDB:
1XX9
PDB:
1AZZ
PDB:
1ECY
PDB:
1ECZ
PDB:
1EZS
PDB:
1EZU
PDB:
1ID5
PDB:
1IFG
PDB:
1N8O
PDB:
1P0S
PDB:
1SLU
PDB:
1SLV
PDB:
1SLW
PDB:
1SLX
PFAM:
PF03974
PRIDE:
P23827
PRODB:
PRO_000022500
REFSEQ:
NP_416713
SMR:
P23827
UNIPROT:
P23827


Operon      
Name: eco         
Operon arrangement:
Transcription unit        Promoter
eco


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ecop5 2303797 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ecop7 2303851 forward Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Brown KC., Yu Z., Burlingame AL., Craik CS., 1998, Determining protein-protein interactions by oxidative cross-linking of a glycine-glycine-histidine fusion protein., Biochemistry 37(13):4397-406

 [2] Corey DR., Shiau AK., Yang Q., Janowski BA., Craik CS., 1993, Trypsin display on the surface of bacteriophage., Gene 128(1):129-34

 [3] Erpel T., Hwang P., Craik CS., Fletterick RJ., McGrath ME., 1992, Physical map location of the new Escherichia coli gene eco, encoding the serine protease inhibitor ecotin., J Bacteriol 174(5):1704

 [4] Lengyel Z., Pal G., Sahin-Toth M., 1998, Affinity purification of recombinant trypsinogen using immobilized ecotin., Protein Expr Purif 12(2):291-4

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB