RegulonDB RegulonDB 10.9: Gene Form
   

entB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

entE entB entA entH entHp entHp

Gene      
Name: entB    Texpresso search in the literature
Synonym(s): ECK0588, EG10260, b0595, entG
Genome position(nucleotides): 627694 --> 628551 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.36
External database links:  
ASAP:
ABE-0002052
CGSC:
821
ECHOBASE:
EB0256
ECOLIHUB:
entB
OU-MICROARRAY:
b0595
STRING:
511145.b0595
COLOMBOS: entB


Product      
Name: enterobactin synthase component B
Synonym(s): EntB, EntG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 32.554
Isoelectric point: 4.851
Motif(s):
 
Type Positions Sequence
242 -> 242 G
263 -> 263 D
264 -> 264 F
249 -> 249 M
209 -> 284 APIPASKAALREVILPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLSREV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.14 - enterochelin (enterobactin)
  2 - information transfer --> 2.3 - protein related --> 2.3.9 - Non-ribosomal peptide synthetase
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0003824 - catalytic activity
GO:0016765 - transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0008908 - isochorismatase activity
GO:0000287 - magnesium ion binding
GO:0031177 - phosphopantetheine binding
GO:0042802 - identical protein binding
GO:0047527 - 2,3-dihydroxybenzoate-serine ligase activity
biological_process GO:0008152 - metabolic process
GO:0009239 - enterobactin biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [1] Chen D., et al., 2009
[2] Gehring AM., et al., 1998
[3] Hubrich F., et al., 2013
[4] Khalil S., et al., 2009
[5] Woodrow GC., et al., 1975
[6] Zhou Z., et al., 2007
External database links:  
DIP:
DIP-9512N
ECOCYC:
ENTB-MONOMER
ECOLIWIKI:
b0595
INTERPRO:
IPR016291
INTERPRO:
IPR009081
INTERPRO:
IPR000868
INTERPRO:
IPR036736
INTERPRO:
IPR036380
MODBASE:
P0ADI4
PDB:
4IZ6
PDB:
3RG2
PDB:
2FQ1
PFAM:
PF00857
PFAM:
PF00550
PRIDE:
P0ADI4
PRINTS:
PR01398
PRODB:
PRO_000022520
PROSITE:
PS50075
REFSEQ:
NP_415127
SMR:
P0ADI4
SWISSMODEL:
P0ADI4
UNIPROT:
P0ADI4


Operon      
Name: entCEBAH         
Operon arrangement:
Transcription unit        Promoter
entCEBA-ybdB
entH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Chen D., Wu R., Bryan TL., Dunaway-Mariano D., 2009, In vitro kinetic analysis of substrate specificity in enterobactin biosynthetic lower pathway enzymes provides insight into the biochemical function of the hot dog-fold thioesterase EntH., Biochemistry 48(3):511-3

 [2] Gehring AM., Mori I., Walsh CT., 1998, Reconstitution and characterization of the Escherichia coli enterobactin synthetase from EntB, EntE, and EntF., Biochemistry 37(8):2648-59

 [3] Hubrich F., Mordhorst S., Andexer JN., 2013, Cinnamic acid derivatives as inhibitors for chorismatases and isochorismatases., Bioorg Med Chem Lett 23(5):1477-81

 [4] Khalil S., Pawelek PD., 2009, Ligand-induced conformational rearrangements promote interaction between the Escherichia coli enterobactin biosynthetic proteins EntE and EntB., J Mol Biol 393(3):658-71

 [5] Woodrow GC., Young IG., Gibson F., 1975, Mu-induced polarity in the Escherichia coli K-12 ent gene cluster: evidence for a gene (entG) involved in the biosynthesis of enterochelin., J Bacteriol 124(1):1-6

 [6] Zhou Z., Lai JR., Walsh CT., 2007, Directed evolution of aryl carrier proteins in the enterobactin synthetase., Proc Natl Acad Sci U S A 104(28):11621-6


RegulonDB