RegulonDB RegulonDB 10.9: Gene Form
   

entE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

entE entC entB Fur

Gene      
Name: entE    Texpresso search in the literature
Synonym(s): ECK0587, EG10263, b0594
Genome position(nucleotides): 626070 --> 627680 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.05
External database links:  
ASAP:
ABE-0002049
CGSC:
818
ECHOBASE:
EB0259
ECOLIHUB:
entE
OU-MICROARRAY:
b0594
STRING:
511145.b0594
COLOMBOS: entE


Product      
Name: 2,3-dihydroxybenzoate-AMP ligase
Synonym(s): EntE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 59.112
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence
37 -> 437 SDSIAVIDGERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLALFSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLLNDSGEHNLQDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQQTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPPAVSLWLQALIEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVNYTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQHNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINR
473 -> 473 K
438 -> 439 GG
369 -> 378 DAEGNPLPQG
446 -> 520 EIENLLLRHPAVIYAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTAVGK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.14 - enterochelin (enterobactin)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016874 - ligase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008668 - (2,3-dihydroxybenzoyl)adenylate synthase activity
GO:0047527 - 2,3-dihydroxybenzoate-serine ligase activity
biological_process GO:0009239 - enterobactin biosynthetic process
GO:0019290 - siderophore biosynthetic process
External database links:  
DIP:
DIP-9515N
ECOCYC:
ENTE-MONOMER
ECOLIWIKI:
b0594
INTERPRO:
IPR011963
INTERPRO:
IPR000873
INTERPRO:
IPR025110
INTERPRO:
IPR042099
INTERPRO:
IPR020845
MODBASE:
P10378
PDB:
6IYL
PDB:
6IYK
PDB:
4IZ6
PDB:
3RG2
PFAM:
PF00501
PFAM:
PF13193
PRIDE:
P10378
PRODB:
PRO_000022523
PROSITE:
PS00455
REFSEQ:
NP_415126
SMR:
P10378
SWISSMODEL:
P10378
UNIPROT:
P10378


Operon      
Name: entCEBAH         
Operon arrangement:
Transcription unit        Promoter
entCEBA-ybdB
entH


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB