RegulonDB RegulonDB 10.9: Gene Form
   

acrE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

acrF acrE envR anti-terminator anti-anti-terminator TSS_3599 TSS_3599 acrEp acrEp envRp14 envRp14 envRp15 envRp15 envRp9 envRp9 envRp12 envRp12 envRp13 envRp13 envRp11 envRp11

Gene      
Name: acrE    Texpresso search in the literature
Synonym(s): ECK3252, EG10266, b3265, envC
Genome position(nucleotides): 3413864 --> 3415021 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.07
External database links:  
ASAP:
ABE-0010722
CGSC:
813
ECHOBASE:
EB0262
ECOLIHUB:
acrE
OU-MICROARRAY:
b3265
STRING:
511145.b3265
COLOMBOS: acrE


Product      
Name: multidrug efflux pump membrane fusion lipoprotein AcrE
Synonym(s): AcrE, EnvC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 41.318
Isoelectric point: 6.275
Motif(s):
 
Type Positions Sequence
1 -> 23 MTKHARFFLLPSFILISAALIAG
24 -> 385 CNDKGEEKAHVGEPQVTVHIVKTAPLEVKTELPGRTNAYRIAEVRPQVSGIVLNRNFTEGSDVQAGQSLYQIDPATYQANYDSAKGELAKSEAAAAIAHLTVKRYVPLVGTKYISQQEYDQAIADARQADAAVIAAKATVESARINLAYTKVTAPISGRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDFMRLKQSVEQGNLHKENATSNVELVMENGQTYPLKGTLQFSDVTVDESTGSITLRAVFPNPQHTLLPGMFVRARIDEGVQPDAILIPQQGVSRTPRGDATVLIVNDKSQVEARPVVASQAIGDKWLISEGLKSGDQVIVSGLQKARPGEQVKATTDTPADTASK
155 -> 359 AVIAAKATVESARINLAYTKVTAPISGRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDFMRLKQSVEQGNLHKENATSNVELVMENGQTYPLKGTLQFSDVTVDESTGSITLRAVFPNPQHTLLPGMFVRARIDEGVQPDAILIPQQGVSRTPRGDATVLIVNDKSQVEARPVVASQAIGDKWLISEGLKSGDQVI
191 -> 212 GALVTNGQTTELATVQQLDPIY
59 -> 292 TNAYRIAEVRPQVSGIVLNRNFTEGSDVQAGQSLYQIDPATYQANYDSAKGELAKSEAAAAIAHLTVKRYVPLVGTKYISQQEYDQAIADARQADAAVIAAKATVESARINLAYTKVTAPISGRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDFMRLKQSVEQGNLHKENATSNVELVMENGQTYPLKGTLQFSDVTVDESTGSITLRAVFPNPQHTLLPGMFV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0031226 - intrinsic component of plasma membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:0042910 - xenobiotic transmembrane transporter activity
biological_process GO:0042493 - response to drug
GO:0046677 - response to antibiotic
GO:0055085 - transmembrane transport
GO:0042908 - xenobiotic transport
Note(s): Note(s): ...[more].
Reference(s): [1] Gonnet P., et al., 2004
[2] Jindal S., et al., 2019
[3] Klein JR., et al., 1991
External database links:  
ECOCYC:
EG10266-MONOMER
ECOLIWIKI:
b3265
INTERPRO:
IPR006143
INTERPRO:
IPR032317
MODBASE:
P24180
PFAM:
PF16576
PFAM:
PF00529
PRIDE:
P24180
PROSITE:
PS51257
REFSEQ:
NP_417731
SMR:
P24180
SWISSMODEL:
P24180
UNIPROT:
P24180


Operon      
Name: acrEF         
Operon arrangement:
Transcription unit        Promoter
acrEF


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter envRp11 3413487 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp13 3413601 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp12 3413602 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp9 3413607 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp15 3413621 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter envRp14 3413633 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_3599 3417381 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [2] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [3] Klein JR., Henrich B., Plapp R., 1991, Molecular analysis and nucleotide sequence of the envCD operon of Escherichia coli., Mol Gen Genet 230(1-2):230-40

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB