RegulonDB RegulonDB 10.9: Gene Form
   

exbB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metC exbB exbD unknown unknown Fur Fur Fur metCp metCp exbBp exbBp exbDp exbDp

Gene      
Name: exbB    Texpresso search in the literature
Synonym(s): ECK2999, EG10271, b3006
Genome position(nucleotides): 3151250 <-- 3151984 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.06
External database links:  
ASAP:
ABE-0009869
CGSC:
804
ECHOBASE:
EB0267
ECOLIHUB:
exbB
OU-MICROARRAY:
b3006
STRING:
511145.b3006
COLOMBOS: exbB


Shine dalgarno      
Sequence: acttgcgtccTGGAGAtacacAGT


Product      
Name: Ton complex subunit ExbB
Synonym(s): ExbB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.287
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
16 -> 39 YQHADIVVKCVMIGLILASVVTWA
144 -> 151 GLFGTVWG
97 -> 203 LSEGSDDNEGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIG
162 -> 194 TQTTNLAVVAPGIAEALLATAIGLVAAIPAVVI
128 -> 155 RGNGYLATIGAISPFVGLFGTVWGIMNS

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.C - Ion-gradient-driven energizers
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0098797 - plasma membrane protein complex
molecular_function GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0031992 - energy transducer activity
biological_process GO:0050821 - protein stabilization
GO:0015031 - protein transport
GO:0015889 - cobalamin transport
GO:0017038 - protein import
GO:0043213 - bacteriocin transport
GO:0055085 - transmembrane transport
GO:0042928 - ferrichrome import into cell
Note(s): Note(s): ...[more].
Reference(s): [1] Braun V., et al., 1993
[2] Karlsson M., et al., 1993
[3] Ollis AA., et al., 2009
External database links:  
DIP:
DIP-47841N
ECOCYC:
EG10271-MONOMER
ECOLIWIKI:
b3006
INTERPRO:
IPR014164
INTERPRO:
IPR002898
PDB:
6TYI
PDB:
5ZFV
PDB:
5ZFU
PDB:
5ZFP
PDB:
5SV1
PDB:
5SV0
PFAM:
PF01618
PRIDE:
P0ABU7
PRODB:
PRO_000022554
REFSEQ:
NP_417479
SMR:
P0ABU7
UNIPROT:
P0ABU7


Operon      
Name: exbBD         
Operon arrangement:
Transcription unit        Promoter
exbD
exbBD


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Braun V., Herrmann C., 1993, Evolutionary relationship of uptake systems for biopolymers in Escherichia coli: cross-complementation between the TonB-ExbB-ExbD and the TolA-TolQ-TolR proteins., Mol Microbiol 8(2):261-8

 [2] Karlsson M., Hannavy K., Higgins CF., 1993, ExbB acts as a chaperone-like protein to stabilize TonB in the cytoplasm., Mol Microbiol 8(2):389-96

 [3] Ollis AA., Manning M., Held KG., Postle K., 2009, Cytoplasmic membrane protonmotive force energizes periplasmic interactions between ExbD and TonB., Mol Microbiol 73(3):466-81


RegulonDB