RegulonDB RegulonDB 10.9: Gene Form
   

exbD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yghA exbB exbD unknown unknown Fur exbDp exbDp

Gene      
Name: exbD    Texpresso search in the literature
Synonym(s): ECK2998, EG10272, b3005
Genome position(nucleotides): 3150818 <-- 3151243 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.23
External database links:  
ASAP:
ABE-0009866
CGSC:
33384
ECHOBASE:
EB0268
ECOLIHUB:
exbD
OU-MICROARRAY:
b3005
STRING:
511145.b3005
COLOMBOS: exbD


Shine dalgarno      
Sequence: aaattacgcgCAGGATaatatccGAT


Product      
Name: Ton complex subunit ExbD
Synonym(s): ExbD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.527
Isoelectric point: 4.469
Motif(s):
 
Type Positions Sequence
23 -> 43 FIDVMLVLLIIFMVAAPLATV
25 -> 25 D
13 -> 134 GEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVG
132 -> 132 L

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.C - Ion-gradient-driven energizers
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0098797 - plasma membrane protein complex
molecular_function GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:0031992 - energy transducer activity
biological_process GO:0050821 - protein stabilization
GO:0015031 - protein transport
GO:0043213 - bacteriocin transport
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Garcia-Herrero A., et al., 2007
[2] Ollis AA., et al., 2009
External database links:  
DIP:
DIP-47973N
ECOCYC:
EG10272-MONOMER
ECOLIWIKI:
b3005
INTERPRO:
IPR014170
INTERPRO:
IPR003400
PANTHER:
PTHR30558
PDB:
6TYI
PDB:
5ZFV
PDB:
5ZFU
PDB:
5SV1
PDB:
2PFU
PFAM:
PF02472
PRIDE:
P0ABV2
PRODB:
PRO_000022555
REFSEQ:
NP_417478
SMR:
P0ABV2
UNIPROT:
P0ABV2


Operon      
Name: exbBD         
Operon arrangement:
Transcription unit        Promoter
exbD
exbBD


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Garcia-Herrero A., Peacock RS., Howard SP., Vogel HJ., 2007, The solution structure of the periplasmic domain of the TonB system ExbD protein reveals an unexpected structural homology with siderophore-binding proteins., Mol Microbiol 66(4):872-89

 [2] Ollis AA., Manning M., Held KG., Postle K., 2009, Cytoplasmic membrane protonmotive force energizes periplasmic interactions between ExbD and TonB., Mol Microbiol 73(3):466-81


RegulonDB