RegulonDB RegulonDB 10.9: Gene Form
   

accC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

accC accB yhdT panF terminator anti-anti-terminator anti-terminator yhdTp yhdTp

Gene      
Name: accC    Texpresso search in the literature
Synonym(s): ECK3243, EG10276, b3256, fabG
Genome position(nucleotides): 3405917 --> 3407266 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.41
External database links:  
ASAP:
ABE-0010677
CGSC:
29834
ECHOBASE:
EB0272
ECOLIHUB:
accC
MIM:
210200
OU-MICROARRAY:
b3256
STRING:
511145.b3256
COLOMBOS: accC


Product      
Name: biotin carboxylase
Synonym(s): AccC, FabG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.321
Isoelectric point: 7.117
Motif(s):
 
Type Positions Sequence
136 -> 136 G
336 -> 441 ECRINAEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDLQIRIMNDENFQHGGTNIHYLE
115 -> 323 DKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSI
160 -> 160 A
313 -> 313 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003989 - acetyl-CoA carboxylase activity
GO:0004075 - biotin carboxylase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0006633 - fatty acid biosynthetic process
GO:0045717 - negative regulation of fatty acid biosynthetic process
GO:2001295 - malonyl-CoA biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9035N
ECOCYC:
BIOTIN-CARBOXYL-MONOMER
ECOLIWIKI:
b3256
INTERPRO:
IPR005481
INTERPRO:
IPR005482
INTERPRO:
IPR011054
INTERPRO:
IPR004549
INTERPRO:
IPR005479
INTERPRO:
IPR011764
INTERPRO:
IPR013815
INTERPRO:
IPR016185
INTERPRO:
IPR011761
MODBASE:
P24182
PDB:
2V58
PDB:
6OI9
PDB:
4HR7
PDB:
3RV4
PDB:
3RV3
PDB:
3RUP
PDB:
3JZI
PDB:
3JZF
PDB:
3G8D
PDB:
3G8C
PDB:
2W71
PDB:
2W70
PDB:
2W6Z
PDB:
1BNC
PDB:
1DV1
PDB:
1DV2
PDB:
1K69
PDB:
2GPS
PDB:
2GPW
PDB:
2J9G
PDB:
2V59
PDB:
2V5A
PDB:
2VR1
PDB:
2W6M
PDB:
2W6N
PDB:
2W6O
PDB:
2W6P
PDB:
2W6Q
PFAM:
PF00289
PFAM:
PF02786
PFAM:
PF02785
PRIDE:
P24182
PRODB:
PRO_000022034
PROSITE:
PS50975
PROSITE:
PS50979
PROSITE:
PS00866
PROSITE:
PS00867
REFSEQ:
NP_417722
SMART:
SM00878
SMR:
P24182
UNIPROT:
P24182


Operon      
Name: accBC         
Operon arrangement:
Transcription unit        Promoter
accBC
accBC


Transcriptional Regulation      
Display Regulation             
Activated by: FadR
Repressed by: AccB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB