RegulonDB RegulonDB 10.9: Gene Form
   

fecB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fecA fecC fecD fecB fecEp4 fecEp4 fecEp5 fecEp5 fecEp3 fecEp3

Gene      
Name: fecB    Texpresso search in the literature
Synonym(s): ECK4280, EG10287, b4290
Genome position(nucleotides): 4513406 <-- 4514308 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.7
External database links:  
ASAP:
ABE-0014065
CGSC:
782
ECHOBASE:
EB0283
ECOLIHUB:
fecB
OU-MICROARRAY:
b4290
STRING:
511145.b4290
COLOMBOS: fecB


Product      
Name: ferric citrate ABC transporter periplasmic binding protein
Synonym(s): FecB, ferric dicitrate ABC transporter - periplasmic binding protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 33.146
Isoelectric point: 9.458
Motif(s):
 
Type Positions Sequence
183 -> 183 R
1 -> 21 MLAFIRFLFAGLLLVISHAFA
22 -> 300 ATVQDEHGTFTLEKTPQRIVVLELSFADALAAVDVIPIGIADDNDAKRILPEVRAHLKPWQSVGTRAQPSLEAIAALKPDLIIADSSRHAGVYIALQQIAPVLLLKSRNETYAENLQSAAIIGEMVGKKREMQARLEQHKERMAQWASQLPKGTRVAFGTSREQQFNLHTQETWTGSVLASLGLNVPAAMAGASMPSIGLEQLLAVNPAWLLVAHYREESIVKRWQQDPLWQMLTAAQKQQVASVDSNTWARMRGIFAAERIAADTVKIFHHQPLTVVK
8 -> 8 L
222 -> 222 E

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
biological_process GO:0006811 - ion transport
GO:0055072 - iron ion homeostasis
GO:0010039 - response to iron ion
GO:0033214 - siderophore-dependent iron import into cell
Note(s): Note(s): ...[more].
Reference(s): [1] Braun V., et al., 2007
[2] Chu BC., et al., 2011
[3] Hussein S., et al., 1981
[4] Pressler U., et al., 1988
[5] Staudenmaier H., et al., 1989
[6] Zimmermann L., et al., 1984
External database links:  
DIP:
DIP-9584N
ECOCYC:
FECB-MONOMER
ECOLIWIKI:
b4290
INTERPRO:
IPR002491
MODBASE:
P15028
PFAM:
PF01497
PRIDE:
P15028
PRODB:
PRO_000022592
PROSITE:
PS50983
REFSEQ:
NP_418710
SMR:
P15028
UNIPROT:
P15028


Operon      
Name: fecABCDE         
Operon arrangement:
Transcription unit        Promoter
fecABCDE


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PdhR
Repressed by: Fur, HypT
Undetermined regulation AscG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter fecEp3 4511530 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter fecEp5 4511639 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter fecEp4 4511644 reverse Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Braun V., Herrmann C., 2007, Docking of the periplasmic FecB binding protein to the FecCD transmembrane proteins in the ferric citrate transport system of Escherichia coli., J Bacteriol 189(19):6913-8

 [2] Chu BC., Vogel HJ., 2011, A structural and functional analysis of type III periplasmic and substrate binding proteins: their role in bacterial siderophore and heme transport., Biol Chem 392(1-2):39-52

 [3] Hussein S., Hantke K., Braun V., 1981, Citrate-dependent iron transport system in Escherichia coli K-12., Eur J Biochem 117(2):431-7

 [4] Pressler U., Staudenmaier H., Zimmermann L., Braun V., 1988, Genetics of the iron dicitrate transport system of Escherichia coli., J Bacteriol 170(6):2716-24

 [5] Staudenmaier H., Van Hove B., Yaraghi Z., Braun V., 1989, Nucleotide sequences of the fecBCDE genes and locations of the proteins suggest a periplasmic-binding-protein-dependent transport mechanism for iron(III) dicitrate in Escherichia coli., J Bacteriol 171(5):2626-33

 [6] Zimmermann L., Hantke K., Braun V., 1984, Exogenous induction of the iron dicitrate transport system of Escherichia coli K-12., J Bacteriol 159(1):271-7

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB