RegulonDB RegulonDB 10.9: Gene Form
   

flhD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insAB5 flhC insB5 flhD insA5 OmpR LrhA IHF CRP AcrR YjjQ RcsAB FliZ OmpR Fur CpxR anti-anti-terminator anti-terminator terminator TSS_2232 TSS_2232 flhDp2 flhDp2 flhDp flhDp flhCp3 flhCp3 motAp motAp TSS_2231 TSS_2231

Gene      
Name: flhD    Texpresso search in the literature
Synonym(s): ECK1893, EG10320, b1892, flbB
Genome position(nucleotides): 1977847 <-- 1978197 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.44
External database links:  
ASAP:
ABE-0006303
CGSC:
749
ECHOBASE:
EB0316
ECOLIHUB:
flhD
OU-MICROARRAY:
b1892
STRING:
511145.b1892
COLOMBOS: flhD


Product      
Name: DNA-binding transcriptional dual regulator FlhD
Synonym(s): FlbB, FlhD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.316
Isoelectric point: 7.073
Motif(s):
 
Type Positions Sequence
1 -> 100 MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLAALTLPQMVKLAETNQLVCHFRFDSHQTITQLTQDSRVDDLQQIHTGIMLSTRL
92 -> 92 T
84 -> 84 V
2 -> 2 H
34 -> 34 F

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0044780 - bacterial-type flagellum assembly
GO:0044781 - bacterial-type flagellum organization
GO:1902208 - regulation of bacterial-type flagellum assembly
Reference(s): [1] Claret L., et al., 2002
[2] Liu X., et al., 1994
External database links:  
DIP:
DIP-9646N
ECOCYC:
EG10320-MONOMER
ECOLIWIKI:
b1892
INTERPRO:
IPR023559
INTERPRO:
IPR036194
MODBASE:
P0A8S9
PDB:
4ES4
PDB:
1G8E
PDB:
2AVU
PFAM:
PF05247
PRIDE:
P0A8S9
PRODB:
PRO_000022653
REFSEQ:
NP_416406
SMR:
P0A8S9
UNIPROT:
P0A8S9


Operon      
Name: flhDC         
Operon arrangement:
Transcription unit        Promoter
flhDC
flhDC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, QseB
Repressed by: FliZ, HdfR, OmpR, LrhA, YjjQ, Fur, MatA, IHF, RcsAB, AcrR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2231 1977300 reverse nd [RS-EPT-CBR] [3]
  promoter flhCp3 1977932 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Claret L., Hughes C., 2002, Interaction of the atypical prokaryotic transcription activator FlhD2C2 with early promoters of the flagellar gene hierarchy., J Mol Biol 321(2):185-99

 [2] Liu X., Matsumura P., 1994, The FlhD/FlhC complex, a transcriptional activator of the Escherichia coli flagellar class II operons., J Bacteriol 176(23):7345-51

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB