RegulonDB RegulonDB 11.1: Gene Form

ftsZ gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

ftsA ftsZ lpxC ftsQ Qin prophage;  DicF ppGpp ppGpp TSS_194 TSS_194 lpxCp2 lpxCp2 lpxCp1 lpxCp1 TSS_192 TSS_192 TSS_191 TSS_191 TSS_190 TSS_190 TSS_189 (cluster) TSS_189 (cluster) TSS_188 TSS_188 TSS_187 TSS_187 TSS_186 TSS_186 ftsZp2 ftsZp2 ftsZp3 ftsZp3 ftsZp4 ftsZp4 TSS_185 TSS_185 TSS_184 TSS_184

Name: ftsZ    Texpresso search in the literature
Synonym(s): ECK0096, EG10347, b0095, sfiB, sulB
Genome position(nucleotides): 105305 --> 106456
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
External database links:  

Name: cell division protein FtsZ
Synonym(s): FtsZ, SfiB, SulB, essential cell division protein FtsZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 40.324
Isoelectric point: 4.38
Type Positions Sequence Comment
1 -> 32 MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRE UniProt: No interaction with MreB or CbtA (YeeV)..
20 -> 24 GGGGN UniProt: GTP.
32 -> 39 ERIEGVEF UniProt: In Ref. 5; AAA23818..
33 -> 49 RIEGVEFFAVNTDAQAL UniProt: No interaction with CtpA..


Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:1990586 - divisome complex
GO:0005737 - cytoplasm
GO:0005886 - plasma membrane
GO:0032153 - cell division site
molecular_function GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0043093 - FtsZ-dependent cytokinesis
GO:0000917 - division septum assembly
GO:0051258 - protein polymerization
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Evidence: [EXP-IMP] Inferred from mutant phenotype
Reference(s): [1] Dai K., et al., 1991
[2] Duron F., et al., 1987
[3] Egan AJF., et al., 2020
[4] Ho SH., et al., 2019
[5] Monterroso B., et al., 2019
[6] Soderstrom B., et al., 2019
[7] Yoshii Y., et al., 2019
External database links:  

Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter

Transcriptional Regulation      
Display Regulation             
Activated by: RcsB
Repressed by: MraZ, LexA, SdiA, PdhR

Regulation by small RNA    
  Display Regulation
small RNA dicF

Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_184 104188 forward nd [RS-EPT-CBR] [8]
  promoter TSS_185 104305 forward nd [RS-EPT-CBR] [8]
  promoter TSS_186 105087 forward nd [RS-EPT-CBR] [8]
  promoter TSS_187 105093 forward nd [RS-EPT-CBR] [8]
  promoter TSS_188 105291 forward nd [RS-EPT-CBR] [8]
  promoter TSS_189 (cluster) 105669 forward nd [RS-EPT-CBR] [8]
  promoter TSS_190 105677 forward nd [RS-EPT-CBR] [8]
  promoter TSS_191 105795 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_192 105816 forward nd [RS-EPT-CBR] [8]
  promoter TSS_194 106940 forward nd [RS-EPT-CBR] [8]


 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


 [1] Dai K., Lutkenhaus J., 1991, ftsZ is an essential cell division gene in Escherichia coli., J Bacteriol 173(11):3500-6

 [2] Duron F., Talbot JN., Feron R., Aubert P., Milhaud G., 1987, Clinical value of thyrotropin binding inhibiting immunoglobulins (TBII) assay in hyperthyroidism., Biomed Pharmacother 41(7):383-8

 [3] Egan AJF., Errington J., Vollmer W., 2020, Regulation of peptidoglycan synthesis and remodelling., Nat Rev Microbiol 18(8):446-460

 [4] Ho SH., Tirrell DA., 2019, Enzymatic Labeling of Bacterial Proteins for Super-resolution Imaging in Live Cells., ACS Cent Sci 5(12):1911-1919

 [5] Monterroso B., Zorrilla S., Sobrinos-Sanguino M., Robles-Ramos MA., Lopez-Alvarez M., Margolin W., Keating CD., Rivas G., 2019, Bacterial FtsZ protein forms phase-separated condensates with its nucleoid-associated inhibitor SlmA., EMBO Rep 20(1)

 [6] Soderstrom B., Chan H., Daley DO., 2019, Super-resolution images of peptidoglycan remodelling enzymes at the division site of Escherichia coli., Curr Genet 65(1):99-101

 [7] Yoshii Y., Niki H., Shiomi D., 2019, Division-site localization of RodZ is required for efficient Z ring formation in Escherichia coli., Mol Microbiol 111(5):1229-1244

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.
