RegulonDB RegulonDB 10.9: Gene Form
   

mokC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nhaA insL1 unknown mokC hokC sokC NhaR NhaR NhaR NhaR terminator TSS_43 TSS_43 TSS_42 TSS_42 nhaAp1 nhaAp1 nhaAp2 nhaAp2 TSS_41 TSS_41 hokCp4 hokCp4

Gene      
Name: mokC    Texpresso search in the literature
Synonym(s): ECK0018, EG10373, b0018, gefL
Genome position(nucleotides): 16751 <-- 16960 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.43
External database links:  
ASAP:
ABE-0000064
ECHOBASE:
EB1999
ECOLIHUB:
mokC
OU-MICROARRAY:
b0018
STRING:
511145.b0018
COLOMBOS: mokC


Product      
Name: regulatory protein MokC
Synonym(s): GefL, MokC, regulatory peptide whose translation enables hokC (gef) expression
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.742
Isoelectric point: 9.443
Motif(s):
 
Type Positions Sequence
25 -> 66 AMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAY
24 -> 44 KAMIVALIVICITAVVAALVT

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Pedersen K., et al., 1999
External database links:  
ECOCYC:
EG10373-MONOMER
ECOLIWIKI:
b0018
INTERPRO:
IPR000021
INTERPRO:
IPR018084
PFAM:
PF01848
PRIDE:
P33236
PRINTS:
PR00281
PROSITE:
PS00556
REFSEQ:
NP_414559
UNIPROT:
P33236


Operon      
Name: mokC-hokC         
Operon arrangement:
Transcription unit        Promoter
mokC-hokC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_39 15463 forward nd [RS-EPT-CBR] [2]
  promoter TSS_40 15553 forward nd [RS-EPT-CBR] [2]
  promoter hokCp4 16951 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_41 16961 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_42 18023 forward nd [RS-EPT-CBR] [2]
  promoter TSS_43 18025 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Pedersen K., Gerdes K., 1999, Multiple hok genes on the chromosome of Escherichia coli., Mol Microbiol 32(5):1090-102

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB