RegulonDB RegulonDB 10.9: Gene Form
   

glmS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glmS glmU pstS PhoB PhoB IHF GlmZ TSS_4289 TSS_4289 TSS_4288 TSS_4288 TSS_4287 TSS_4287 glmSp2 glmSp2 TSS_4286 TSS_4286 TSS_4285 TSS_4285 TSS_4284 TSS_4284 TSS_4283 TSS_4283 TSS_4282 TSS_4282 TSS_4281 TSS_4281 pstSp pstSp pstCp pstCp

Gene      
Name: glmS    Texpresso search in the literature
Synonym(s): ECK3722, EG10382, b3729
Genome position(nucleotides): 3911839 <-- 3913668 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.55
External database links:  
ASAP:
ABE-0012198
CGSC:
706
ECHOBASE:
EB0377
ECOLIHUB:
glmS
OU-MICROARRAY:
b3729
STRING:
511145.b3729
COLOMBOS: glmS


Product      
Name: L-glutamine—D-fructose-6-phosphate aminotransferase
Synonym(s): GlmS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 66.894
Isoelectric point: 5.741
Motif(s):
 
Type Positions Sequence
419 -> 420 KL
462 -> 591 FSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALI
2 -> 609 CGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAEEHPLHGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFVSETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLVIGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDKTGAEVKRQDIESNLQYDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILACGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLRLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLSRLKGLDASIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPRNLAKSVTVE
458 -> 599 LAEDFSDKHHALFLGRGDQYPIALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRARGGQLYVFADQDAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQP
65 -> 180 HGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFVSETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.1 - O antigen
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.12 - amino sugar conversions
  6 - cell structure --> 6.2 - murein
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0004360 - glutamine-fructose-6-phosphate transaminase (isomerizing) activity
GO:0097367 - carbohydrate derivative binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006541 - glutamine metabolic process
GO:0006047 - UDP-N-acetylglucosamine metabolic process
GO:0006048 - UDP-N-acetylglucosamine biosynthetic process
GO:0006002 - fructose 6-phosphate metabolic process
GO:0006487 - protein N-linked glycosylation
GO:1901135 - carbohydrate derivative metabolic process
GO:1901137 - carbohydrate derivative biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9775N
ECOCYC:
L-GLN-FRUCT-6-P-AMINOTRANS-MONOMER
ECOLIWIKI:
b3729
INTERPRO:
IPR035490
INTERPRO:
IPR035466
INTERPRO:
IPR017932
INTERPRO:
IPR029055
INTERPRO:
IPR001347
INTERPRO:
IPR005855
MODBASE:
P17169
PANTHER:
PTHR10937:SF0
PDB:
2VF5
PDB:
3OOJ
PDB:
2VF4
PDB:
4AMV
PDB:
1JXA
PDB:
1MOQ
PDB:
1MOR
PDB:
1MOS
PDB:
1XFF
PDB:
1XFG
PDB:
2J6H
PFAM:
PF13522
PFAM:
PF01380
PRIDE:
P17169
PRODB:
PRO_000022781
PROSITE:
PS51464
PROSITE:
PS51278
REFSEQ:
NP_418185
SMR:
P17169
UNIPROT:
P17169


Operon      
Name: glmUS         
Operon arrangement:
Transcription unit        Promoter
glmUS
glmUS


Transcriptional Regulation      
Display Regulation             
Activated by: NagC
Repressed by: NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4281 3912376 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4282 3912783 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4283 3912803 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4284 3913003 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4285 3913355 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4286 3913684 reverse nd [RS-EPT-CBR] [1]
  promoter glmSp2 3913811 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4287 3913867 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4288 3913870 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4289 3914025 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB