RegulonDB RegulonDB 10.9: Gene Form
   

ihfA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pheT btuC ihfA IHF IHF IHF terminator TSS_2009 TSS_2009 TSS_2008 TSS_2008 TSS_2007 TSS_2007 ihfAp4 ihfAp4 TSS_2006 TSS_2006 TSS_2005 TSS_2005 TSS_2004 TSS_2004 TSS_2003 TSS_2003

Gene      
Name: ihfA    Texpresso search in the literature
Synonym(s): ECK1710, EG10440, b1712, hid, himA
Genome position(nucleotides): 1795253 <-- 1795552 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0005715
CGSC:
638
ECHOBASE:
EB0435
ECOLIHUB:
ihfA
OU-MICROARRAY:
b1712
STRING:
511145.b1712
COLOMBOS: ihfA


Product      
Name: integration host factor subunit α
Synonym(s): Hid, HimA, IhfA, integration host factor (IHF), alpha; subunit; site specific recombination
Sequence: Get amino acid sequence Fasta Format
Cellular location: bacterial nucleoid,cytosol
Molecular weight: 11.354
Isoelectric point: 10.058
Motif(s):
 
Type Positions Sequence
2 -> 99 ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE
66 -> 66 K
3 -> 91 LTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRV
65 -> 65 P

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006310 - DNA recombination
GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0006417 - regulation of translation
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000746 - conjugation
Note(s): Note(s): ...[more].
Reference(s): [1] Aviv M., et al., 1994
[2] Goosen N., et al., 1995
External database links:  
DIP:
DIP-36031N
ECOCYC:
PD00347
ECOLIWIKI:
b1712
INTERPRO:
IPR000119
INTERPRO:
IPR005684
INTERPRO:
IPR010992
INTERPRO:
IPR020816
MODBASE:
P0A6X7
PANTHER:
PTHR33175
PDB:
5J0N
PDB:
2IIF
PDB:
2IIE
PDB:
2HT0
PDB:
1OWG
PDB:
1OWF
PDB:
1OUZ
PDB:
1IHF
PFAM:
PF00216
PRIDE:
P0A6X7
PRINTS:
PR01727
PRODB:
PRO_000022998
PROSITE:
PS00045
REFSEQ:
NP_416227
SMART:
SM00411
SMR:
P0A6X7
UNIPROT:
P0A6X7


Operon      
Name: thrS-infC-rpmI-rplT-pheMST-ihfA         
Operon arrangement:
Transcription unit        Promoter
ihfA
pheM
pheMST-ihfA
rplT
rplT-pheM
rpmI-rplT
infC-rpmI-rplT
infC
thrS-infC
thrS-infC-rpmI-rplT-pheMST-ihfA


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR, IHF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2003 1795497 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2004 1795523 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2005 1795580 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2006 1795720 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2007 1795767 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2008 1795965 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2009 1797601 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Aviv M., Giladi H., Schreiber G., Oppenheim AB., Glaser G., 1994, Expression of the genes coding for the Escherichia coli integration host factor are controlled by growth phase, rpoS, ppGpp and by autoregulation., Mol Microbiol 14(5):1021-31

 [2] Goosen N., van de Putte P., 1995, The regulation of transcription initiation by integration host factor., Mol Microbiol 16(1):1-7

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB