RegulonDB RegulonDB 10.9: Gene Form
   

hsdM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hsdR hsdM hsdS symR symE LexA terminator TSS_5152 TSS_5152 TSS_5151 TSS_5151 TSS_5150 TSS_5150 TSS_5149 TSS_5149 hsdSp1 hsdSp1 symEp symEp symRp symRp

Gene      
Name: hsdM    Texpresso search in the literature
Synonym(s): ECK4339, EG10458, b4349, hsm, hsp
Genome position(nucleotides): 4581459 <-- 4583048 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.84
External database links:  
ASAP:
ABE-0014260
CGSC:
621
ECHOBASE:
EB0453
ECOLIHUB:
hsdM
OU-MICROARRAY:
b4349
STRING:
511145.b4349
COLOMBOS: hsdM


Product      
Name: type I restriction enzyme EcoKI methyltransferase component
Synonym(s): HsdM, Hsm, Hsp, host modification, DNA methylase M, type I restriction enzyme EcoKI M protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 59.307
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
148 -> 153 QYFTPR
178 -> 180 TAG
123 -> 449 SRDDFGDMYEGLLQKNANETKSGAGQYFTPRPLIKTIIHLLKPQPREVVQDPAAGTAGFLIEADRYVKSQTNDLDDLDGDTQDFQIHRAFIGLELVPGTRRLALMNCLLHDIEGNLDHGGAIRLGNTLGSDGENLPKAHIVATNPPFGSAAGTNITRTFVHPTSNKQLCFMQHIIETLHPGGRAAVVVPDNVLFEGGKGTDIRRDLMDKCHLHTILRLPTGIFYAQGVKTNVLFFTKGTVANPNQDKNCTDDVWVYDLRTNMPSFGKRTPFTDEHLQPFERVYGEDPHGLSPRTEGEWSFNAEETEVADSEENKNTDQHLATSRWRK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.2 - DNA restriction/modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.1 - DNA structure level --> 3.1.1.2 - methylation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0008170 - N-methyltransferase activity
GO:0016740 - transferase activity
GO:0009007 - site-specific DNA-methyltransferase (adenine-specific) activity
biological_process GO:0006306 - DNA methylation
GO:0009307 - DNA restriction-modification system
GO:0032259 - methylation
GO:0032775 - DNA methylation on adenine
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9943N
ECOCYC:
EG10458-MONOMER
ECOLIWIKI:
b4349
INTERPRO:
IPR038333
INTERPRO:
IPR029063
INTERPRO:
IPR022749
INTERPRO:
IPR002052
INTERPRO:
IPR003356
MODBASE:
P08957
PDB:
2Y7H
PDB:
2Y7C
PDB:
2AR0
PFAM:
PF02384
PRIDE:
P08957
PRODB:
PRO_000022928
PROSITE:
PS00092
REFSEQ:
NP_418769
SMR:
P08957
UNIPROT:
P08957


Operon      
Name: hsdRMS         
Operon arrangement:
Transcription unit        Promoter
hsdMS
hsdRMS


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hsdSp1 4581502 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_5149 4582717 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5150 4582723 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5151 4582742 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5152 4586738 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB