RegulonDB RegulonDB 10.9: Gene Form
   

hsdS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hsdR hsdM hsdS symR symE LexA terminator TSS_5152 TSS_5152 TSS_5151 TSS_5151 TSS_5150 TSS_5150 TSS_5149 TSS_5149 hsdSp1 hsdSp1 symEp symEp symRp symRp

Gene      
Name: hsdS    Texpresso search in the literature
Synonym(s): ECK4338, EG10460, b4348, hsp, hss, rm
Genome position(nucleotides): 4580068 <-- 4581462 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.43
External database links:  
ASAP:
ABE-0014258
CGSC:
619
ECHOBASE:
EB0455
ECOLIHUB:
hsdS
ECOO157CYC:
Z5946
OU-MICROARRAY:
b4348
STRING:
511145.b4348
COLOMBOS: hsdS


Product      
Name: type I restriction enzyme EcoKI specificity protein
Synonym(s): HsdS, Hsp, Hss, specificity determinant for hsdM and hsdR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 51.395
Isoelectric point: 10.218
Motif(s):
 
Type Positions Sequence
348 -> 403 MNCVKTTSGQKGISGKDIKSQVVLLPPVKEQAEIVRRVEQLFAYADTIEKQVNNAL
7 -> 190 PEGWVIAPVSTVTTLIRGVTYKKEQAINYLKDDYLPLIRANNIQNGKFDTTDLVFVPKNLVKESQKISPEDIVIAMSSGSKSVVGKSAHQHLPFECSFGAFCGVLRPEKLIFSGFIAHFTKSSLYRNKISSLSAGANINNIKPASFDLINIPIPPLAEQKIIAEKLDTLLAQVDSTKARFEQIP

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.2 - DNA restriction/modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.1 - DNA structure level --> 3.1.1.2 - methylation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006304 - DNA modification
GO:0009307 - DNA restriction-modification system
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9945N
ECOCYC:
EG10460-MONOMER
ECOLIWIKI:
b4348
ECOO157CYC:
Z5946-MONOMER
INTERPRO:
IPR000055
PDB:
2Y7H
PDB:
2Y7C
PFAM:
PF01420
PRIDE:
P05719
PRODB:
PRO_000022930
REFSEQ:
NP_418768
SMR:
P05719
UNIPROT:
P05719


Operon      
Name: hsdRMS         
Operon arrangement:
Transcription unit        Promoter
hsdMS
hsdRMS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter hsdSp1 4581502 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_5149 4582717 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5150 4582723 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5151 4582742 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5152 4586738 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB