RegulonDB RegulonDB 10.9: Gene Form
   

hupA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjaH yjaG hupA CRP Fis Fis Fis Fis yjaHp1 yjaHp1 TSS_4832 TSS_4832 TSS_4831 TSS_4831 TSS_4830 TSS_4830 TSS_4829 (cluster) TSS_4829 (cluster) hupAp hupAp TSS_4827 TSS_4827

Gene      
Name: hupA    Texpresso search in the literature
Synonym(s): ECK3992, EG10466, b4000
Genome position(nucleotides): 4200281 --> 4200553 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.35
External database links:  
ASAP:
ABE-0013077
CGSC:
34243
ECHOBASE:
EB0461
ECOLIHUB:
hupA
OU-MICROARRAY:
b4000
STRING:
511145.b4000
COLOMBOS: hupA


Product      
Name: DNA-binding protein HU-α
Synonym(s): HupA, transcriptional dual regulator HU-alpha; (HU-2)
Sequence: Get amino acid sequence Fasta Format
Cellular location: bacterial nucleoid,cytosol
Molecular weight: 9.535
Isoelectric point: 10.379
Motif(s):
 
Type Positions Sequence
19 -> 32 TQAKAALESTLAAI
1 -> 90 MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  2 - information transfer --> 2.3 - protein related --> 2.3.7 - nucleoproteins, basic proteins
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
GO:1990178 - HU-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006974 - cellular response to DNA damage stimulus
GO:0030261 - chromosome condensation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35892N
ECOCYC:
EG10466-MONOMER
ECOLIWIKI:
b4000
INTERPRO:
IPR020816
INTERPRO:
IPR010992
INTERPRO:
IPR000119
MODBASE:
P0ACF0
PANTHER:
PTHR33175
PDB:
4YEW
PDB:
6OAJ
PDB:
6O8Q
PDB:
4YFT
PDB:
4YFH
PDB:
4YF0
PDB:
4YEY
PDB:
4YEX
PDB:
2O97
PDB:
1MUL
PFAM:
PF00216
PRIDE:
P0ACF0
PRINTS:
PR01727
PRODB:
PRO_000022941
PROSITE:
PS00045
REFSEQ:
NP_418428
SMART:
SM00411
SMR:
P0ACF0
UNIPROT:
P0ACF0


Operon      
Name: hupA         
Operon arrangement:
Transcription unit        Promoter
hupA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4827 4199519 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4829 (cluster) 4200222 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4830 4200230 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4831 4200258 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4832 4200261 forward nd [RS-EPT-CBR] [1]
  promoter yjaHp1 4200511 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB