RegulonDB RegulonDB 10.9: Gene Form
   

hyaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyaB hyaC hyaD hyaE hyaA hyaF

Gene      
Name: hyaC    Texpresso search in the literature
Synonym(s): ECK0965, EG10470, b0974, cybH
Genome position(nucleotides): 1035066 --> 1035773 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.84
External database links:  
ASAP:
ABE-0003290
CGSC:
31788
ECHOBASE:
EB0465
ECOLIHUB:
hyaC
OU-MICROARRAY:
b0974
STRING:
511145.b0974
COLOMBOS: hyaC


Shine dalgarno      
Sequence: ttaacagcgaAGGAGAatcatcATG


Product      
Name: hydrogenase 1 cytochrome b subunit
Synonym(s): CybH, HyaC, hydrogenase 1 - gamma; subunit, hydrogenase 1 - B subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 27.597
Isoelectric point: 9.589
Motif(s):
 
Type Positions Sequence
14 -> 220 FEAPVRIWHWLTVLCMAVLMVTGYFIGKPLPSVSGEATYLFYMGYIRLIHFSAGMVFTVVLLMRIYWAFVGNRYSRELFIVPVWRKSWWQGVWYEIRWYLFLAKRPSADIGHNPIAQAAMFGYFLMSVFMIITGFALYSEHSQYAIFAPFRYVVEFFYWTGGNSMDIHSWHRLGMWLIGAFVIGHVYMALREDIMSDDTVISTMVNG
20 -> 40 IWHWLTVLCMAVLMVTGYFIG
186 -> 203 LGMWLIGAFVIGHVYMAL
64 -> 84 FSAGMVFTVVLLMRIYWAFVG
131 -> 151 AAMFGYFLMSVFMIITGFALY

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0044569 - [Ni-Fe] hydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0005506 - iron ion binding
GO:0020037 - heme binding
GO:0033748 - hydrogenase (acceptor) activity
biological_process GO:0006113 - fermentation
GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0022904 - respiratory electron transport chain
GO:0055114 - oxidation-reduction process
GO:1902421 - hydrogen metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35859N
ECOCYC:
HYAC-MONOMER
ECOLIWIKI:
b0974
INTERPRO:
IPR000516
INTERPRO:
IPR016174
INTERPRO:
IPR011577
MODBASE:
P0AAM1
PDB:
4GD3
PFAM:
PF01292
PRIDE:
P0AAM1
PRINTS:
PR00161
PROSITE:
PS00883
PROSITE:
PS00882
REFSEQ:
NP_415493
SMR:
P0AAM1
UNIPROT:
P0AAM1


Operon      
Name: hyaABCDEF         
Operon arrangement:
Transcription unit        Promoter
hyaABCDEF
hyaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: YdeO, ArcA, AppY
Repressed by: IscR, NarL, NarP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB