RegulonDB RegulonDB 10.9: Gene Form
   

hyaD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hyaB hyaF hyaC hyaD hyaE hyaA

Gene      
Name: hyaD    Texpresso search in the literature
Synonym(s): ECK0966, EG10471, b0975
Genome position(nucleotides): 1035770 --> 1036357 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.84
External database links:  
ASAP:
ABE-0003292
CGSC:
31791
ECHOBASE:
EB0466
ECOLIHUB:
hyaD
OU-MICROARRAY:
b0975
STRING:
511145.b0975
COLOMBOS: hyaD


Shine dalgarno      
Sequence: ataagtaacaAGGAGCgttcATG


Product      
Name: putative hydrogenase 1 maturation protease HyaD
Synonym(s): HyaD, protein involved in processing of HyaA and HyaB proteins
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.546
Isoelectric point: 4.546
Motif(s):
 
Type Positions Sequence
23 -> 151 VRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASHLLILDAIDYGLEPGTLRTYAGERIPAYLSAKKMSLHQNSFSEVLALADIRGHLPAHIALVGLQPAMLDDYGGSLSELAREQLPAAEQAALA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008047 - enzyme activator activity
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0004175 - endopeptidase activity
GO:0004190 - aspartic-type endopeptidase activity
biological_process GO:0006464 - cellular protein modification process
GO:0006508 - proteolysis
GO:0016485 - protein processing
GO:0043085 - positive regulation of catalytic activity
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Menon NK., et al., 1991
External database links:  
DIP:
DIP-9960N
ECOCYC:
EG10471-MONOMER
ECOLIWIKI:
b0975
INTERPRO:
IPR000671
INTERPRO:
IPR023430
INTERPRO:
IPR004419
MODBASE:
P19930
PANTHER:
PTHR30302
PFAM:
PF01750
PRIDE:
P19930
PRINTS:
PR00446
PRODB:
PRO_000022945
REFSEQ:
NP_415494
UNIPROT:
P19930


Operon      
Name: hyaABCDEF         
Operon arrangement:
Transcription unit        Promoter
hyaABCDEF
hyaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: YdeO, ArcA, AppY
Repressed by: IscR, NarL, NarP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Menon NK., Robbins J., Wendt JC., Shanmugam KT., Przybyla AE., 1991, Mutational analysis and characterization of the Escherichia coli hya operon, which encodes [NiFe] hydrogenase 1., J Bacteriol 173(15):4851-61


RegulonDB