RegulonDB RegulonDB 10.9: Gene Form
   

hyaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

appC hyaF hyaC hyaD hyaE YdeO appCp appCp

Gene      
Name: hyaE    Texpresso search in the literature
Synonym(s): ECK0967, EG10472, b0976
Genome position(nucleotides): 1036354 --> 1036752 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.64
External database links:  
ASAP:
ABE-0003294
CGSC:
31794
ECHOBASE:
EB0467
ECOLIHUB:
hyaE
OU-MICROARRAY:
b0976
STRING:
511145.b0976
COLOMBOS: hyaE


Shine dalgarno      
Sequence: gatgacacagGAGGAGcagggATG


Product      
Name: putative HyaA chaperone
Synonym(s): HyaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.89
Isoelectric point: 4.253
Motif(s):
 
Type Positions Sequence
10 -> 116 LWQRMLARGWTPVSESRLDDWLTQAPDGVVLLSSDPKRTPEVSDNPVMIGELLREFPDYTWQVAIADLEQSEAIGDRFGVFRFPATLVFTGGNYRGVLNGIHPWAEL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005048 - signal sequence binding
Note(s): Note(s): ...[more].
Evidence: [IPI] Inferred from physical interaction
Reference(s): [1] Dubini A., et al., 2003
External database links:  
DIP:
DIP-9961N
ECOCYC:
EG10472-MONOMER
ECOLIWIKI:
b0976
INTERPRO:
IPR010893
INTERPRO:
IPR036249
PDB:
2HFD
PFAM:
PF07449
PRIDE:
P19931
PRODB:
PRO_000022946
REFSEQ:
NP_415495
SMR:
P19931
SWISSMODEL:
P19931
UNIPROT:
P19931


Operon      
Name: hyaABCDEF         
Operon arrangement:
Transcription unit        Promoter
hyaABCDEF
hyaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: YdeO, ArcA, AppY
Repressed by: IscR, NarL, NarP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Dubini A., Sargent F., 2003, Assembly of Tat-dependent [NiFe] hydrogenases: identification of precursor-binding accessory proteins., FEBS Lett 549(1-3):141-6


RegulonDB