RegulonDB RegulonDB 10.9: Gene Form
   

hyaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

appC hyaF hyaD hyaE hyaC YdeO appCp appCp

Gene      
Name: hyaF    Texpresso search in the literature
Synonym(s): ECK0968, EG10473, b0977
Genome position(nucleotides): 1036749 --> 1037606 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.9
External database links:  
ASAP:
ABE-0003296
CGSC:
31797
ECHOBASE:
EB0468
ECOLIHUB:
hyaF
OU-MICROARRAY:
b0977
STRING:
511145.b0977
COLOMBOS: hyaF


Shine dalgarno      
Sequence: gaaccgcagcAGGAGCgtgcctcATG


Product      
Name: protein HyaF
Synonym(s): HyaF, protein involved in nickel incorporation into hydrogenase 1 proteins
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.431
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
51 -> 139 ALLNELQHQLSERQPPLGEVLAVDLLNLNADDRHFINTLLGEGEVSVRIQQADDSESEIQEAIFCGLWRVRRRRGEKLLEDKLEAGCAP
164 -> 279 LMNGLPLAHELLAHVRNPDAQPHSINLTQLPISEADRLFLSRLCGPGNIQIRTIGYGESYINATGLRHVWHLRCTDTLKGPLLESYEICPIPEVVLAAPEDLVDSAQRLSEVCQWL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG10473-MONOMER
ECOLIWIKI:
b0977
INTERPRO:
IPR006894
INTERPRO:
IPR038527
PFAM:
PF04809
PRIDE:
P19932
PRODB:
PRO_000022947
REFSEQ:
NP_415496
SMR:
P19932
UNIPROT:
P19932


Operon      
Name: hyaABCDEF         
Operon arrangement:
Transcription unit        Promoter
hyaABCDEF
hyaABCDEF


Transcriptional Regulation      
Display Regulation             
Activated by: YdeO, ArcA, AppY
Repressed by: IscR, NarL, NarP, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB