RegulonDB RegulonDB 10.9: Gene Form
   

lacI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lacZ lacI mhpR CRP LacI H-NS CRP H-NS H-NS MarA H-NS H-NS LacI CRP H-NS LacI terminator lacIp lacIp lacZp4 lacZp4 lacZp2 lacZp2 lacZp3 lacZp3 lacZp1 lacZp1

Gene      
Name: lacI    Texpresso search in the literature
Synonym(s): ECK0342, EG10525, b0345
Genome position(nucleotides): 366428 <-- 367510 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.33
External database links:  
ASAP:
ABE-0001189
CGSC:
578
ECHOBASE:
EB0520
ECOLIHUB:
lacI
OU-MICROARRAY:
b0345
STRING:
511145.b0345
COLOMBOS: lacI


Product      
Name: DNA-binding transcriptional repressor LacI
Synonym(s): LacI, transcriptional repressor of the lac operon
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 38.59
Isoelectric point: 6.883
Motif(s):
 
Type Positions Sequence
171 -> 329 VEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSAMSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSCYIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTT
22 -> 22 R
282 -> 282 Y
5 -> 50 TLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
286 -> 286 L

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042802 - identical protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Beyreuther K., et al., 1975
[2] Boelens R., et al., 1988
[3] Farabaugh PJ. 1978
[4] Ganem D., et al., 1973
[5] Gordon AJ., et al., 1988
[6] Jacob F., et al., 1961
[7] Kisters-Woike B., et al., 1991
[8] Lamerichs RM., et al., 1989
[9] Lehming N., et al., 1990
[10] Markiewicz P., et al., 1994
[11] Pardee AB., et al., 1959
[12] Platt T., et al., 1973
External database links:  
DIP:
DIP-10079N
ECOCYC:
PD00763
ECOLIWIKI:
b0345
INTERPRO:
IPR028082
INTERPRO:
IPR010982
INTERPRO:
IPR000843
MINT:
P03023
MODBASE:
P03023
PDB:
1LCC
PDB:
4RZT
PDB:
4RZS
PDB:
3EDC
PDB:
2PE5
PDB:
2PAF
PDB:
2P9H
PDB:
2KEK
PDB:
2KEJ
PDB:
2KEI
PDB:
2BJC
PDB:
1CJG
PDB:
1EFA
PDB:
1JWL
PDB:
1JYE
PDB:
1JYF
PDB:
1L1M
PDB:
1LBG
PDB:
1LBH
PDB:
1LBI
PDB:
1LCD
PDB:
1LQC
PDB:
1LTP
PDB:
1OSL
PDB:
1TLF
PDB:
1Z04
PFAM:
PF00356
PFAM:
PF13377
PRIDE:
P03023
PRINTS:
PR00036
PRODB:
PRO_000023070
PROSITE:
PS00356
PROSITE:
PS50932
REFSEQ:
NP_414879
SMART:
SM00354
SMR:
P03023
UNIPROT:
P03023


Operon      
Name: mhpR-lacI         
Operon arrangement:
Transcription unit        Promoter
lacI
mhpR-lacI
mhpR-lacI


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Beyreuther K., Adler K., Fanning E., Murray C., Klemm A., Geisler N., 1975, Amino-acid sequence of lac repressor from Escherichia coli. Isolation, sequence analysis and sequence assembly of tryptic peptides and cyanogen-bromide fragments., Eur J Biochem 59(2):491-509

 [2] Boelens R., Lamerichs RM., Rullmann JA., van Boom JH., Kaptein R., 1988, The interaction of lac repressor headpiece with its operator: an NMR view., Protein Seq Data Anal 1(6):487-98

 [3] Farabaugh PJ., 1978, Sequence of the lacI gene., Nature 274(5673):765-9

 [4] Ganem D., Miller JH., Files JG., Platt T., Weber K., 1973, Reinitiation of a lac repressor fragment at a codon other than AUG., Proc Natl Acad Sci U S A 70(11):3165-9

 [5] Gordon AJ., Burns PA., Fix DF., Yatagai F., Allen FL., Horsfall MJ., Halliday JA., Gray J., Bernelot-Moens C., Glickman BW., 1988, Missense mutation in the lacI gene of Escherichia coli. Inferences on the structure of the repressor protein., J Mol Biol 200(2):239-51

 [6] Jacob F., Monod J., 1961, Genetic regulatory mechanisms in the synthesis of proteins., J Mol Biol 3:318-56

 [7] Kisters-Woike B., Lehming N., Sartorius J., von Wilcken-Bergmann B., Muller-Hill B., 1991, A model of the lac repressor-operator complex based on physical and genetic data., Eur J Biochem 198(2):411-9

 [8] Lamerichs RM., Boelens R., van der Marel GA., van Boom JH., Kaptein R., Buck F., Fera B., Ruterjans H., 1989, H NMR study of a complex between the lac repressor headpiece and a 22 base pair symmetric lac operator., Biochemistry 28(7):2985-91

 [9] Lehming N., Sartorius J., Kisters-Woike B., von Wilcken-Bergmann B., Muller-Hill B., 1990, Mutant lac repressors with new specificities hint at rules for protein--DNA recognition., EMBO J 9(3):615-21

 [10] Markiewicz P., Kleina LG., Cruz C., Ehret S., Miller JH., 1994, Genetic studies of the lac repressor. XIV. Analysis of 4000 altered Escherichia coli lac repressors reveals essential and non-essential residues, as well as "spacers" which do not require a specific sequence., J Mol Biol 240(5):421-33

 [11] Pardee AB., Prestidge LS., 1959, On the nature of the repressor of beta-galactosidase synthesis in Escherichia coli., Biochim Biophys Acta 36:545-7

 [12] Platt T., Files JG., Weber K., 1973, Lac repressor. Specific proteolytic destruction of the NH 2 -terminal region and loss of the deoxyribonucleic acid-binding activity., J Biol Chem 248(1):110-21


RegulonDB