RegulonDB RegulonDB 10.9: Gene Form
   

mcrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiV mcrB mcrC symE symR symRp symRp mcrCp5 mcrCp5 TSS_5148 TSS_5148

Gene      
Name: mcrB    Texpresso search in the literature
Synonym(s): ECK4336, EG10574, b4346, rglB
Genome position(nucleotides): 4577958 <-- 4579337 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.36
External database links:  
ASAP:
ABE-0014250
CGSC:
4978
ECHOBASE:
EB0569
ECOLIHUB:
mcrB
OU-MICROARRAY:
b4346
STRING:
511145.b4346
COLOMBOS: mcrB


Product      
Name: McrBS
Synonym(s): McrB, RglB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 34.659
Isoelectric point: 5.016
Motif(s):
 
Type Positions Sequence
333 -> 336 NTAD
245 -> 259 YRPNGVGFRRKDGIF
186 -> 212 TILKRLTIKKNIILQGPPGVGKTFVAR
300 -> 303 DKRG
196 -> 350 NIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYEDFIQGYRPNGVGFRRKDGIFYNFCQQAKEQPEKKYIFIIDEINRANLSKVFGEVMMLMEHDKRGENWSVPLTYSENDEERFYVPENVYIIGLMNTADRSLAVVDYALRRRF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.2 - DNA restriction/modification
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.2 - DNA restriction/modification
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0003924 - GTPase activity
GO:0005524 - ATP binding
GO:0005525 - GTP binding
GO:0015666 - restriction endodeoxyribonuclease activity
GO:0042802 - identical protein binding
GO:0010385 - double-stranded methylated DNA binding
GO:0044729 - hemi-methylated DNA-binding
biological_process GO:0006308 - DNA catabolic process
GO:0009307 - DNA restriction-modification system
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Panne D., et al., 1998
External database links:  
ECOCYC:
MONOMER0-4524
PFAM:
PF07728
UNIPROT:
P15005-2


Operon      
Name: mcrBC         
Operon arrangement:
Transcription unit        Promoter
mcrBC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5148 4574607 forward nd [RS-EPT-CBR] [2]
  promoter mcrCp5 4578062 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Panne D., Raleigh EA., Bickle TA., 1998, McrBs, a modulator peptide for McrBC activity., EMBO J 17(18):5477-83

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB