RegulonDB RegulonDB 10.9: Gene Form
   

metH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metH yjbB iclR MetR FadR IclR Fur terminator TSS_4843 TSS_4843 TSS_4842 TSS_4842 TSS_4841 TSS_4841 yjbBp yjbBp TSS_4839 TSS_4839 metHp metHp iclRp iclRp metHp2 metHp2

Gene      
Name: metH    Texpresso search in the literature
Synonym(s): ECK4011, EG10587, b4019
Genome position(nucleotides): 4223828 --> 4227511 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.84
External database links:  
ASAP:
ABE-0013140
CGSC:
509
ECHOBASE:
EB0582
ECOLIHUB:
metH
MIM:
603174
MIM:
250940
MIM:
156570
MIM:
601634
NCBI-GENE:
948522
OU-MICROARRAY:
b4019
STRING:
511145.b4019
COLOMBOS: metH


Product      
Name: cobalamin-dependent methionine synthase
Synonym(s): MetH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 135.996
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
310 -> 310 C
757 -> 757 D
2 -> 1227 SSKVEQLRAQLNERILVLDGGMGTMIQSYRLNEADFRGERFADWPCDLKGNNDLLVLSKPEVIAAIHNAYFEAGADIIETNTFNSTTIAMADYQMESLSAEINFAAAKLARACADEWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDGLVAAYRESTKALVEGGADLILIETVFDTLNAKAAVFAVKTEFEALGVELPIMISGTITDASGRTLSGQTTEAFYNSLRHAEALTFGLNCALGPDELRQYVQELSRIAECYVTAHPNAGLPNAFGEYDLDADTMAKQIREWAQAGFLNIVGGCCGTTPQHIAAMSRAVEGLAPRKLPEIPVACRLSGLEPLNIGEDSLFVNVGERTNVTGSAKFKRLIKEEKYSEALDVARQQVENGAQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSKWDVIEKGLKCIQGKGIVNSISMKEGVDAFIHHAKLLRRYGAAVVVMAFDEQGQADTRARKIEICRRAYKILTEEVGFPPEDIIFDPNIFAVATGIEEHNNYAQDFIGACEDIKRELPHALISGGVSNVSFSFRGNDPVREAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPAELRDAVEDVILNRRDDGTERLLELAEKYRGSKTDDTANAQQAEWRSWEVNKRLEYSLVKGITEFIEQDTEEARQQATRPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASKEQGKTNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVAALLSDTQRDDFVARTRKEYETVRIQHGRKKPRTPPVTLEAARDNDFAFDWQAYTPPVAHRLGVQEVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGVEAQRLFKDANDMLDKLSAEKTLNPRGVVGLFPANRVGDDIEIYRDETRTHVINVSHHLRQQTEKTGFANYCLADFVAPKLSGKADYIGAFAVTGGLEEDALADAFEAQHDDYNKIMVKALADRLAEAFAEYLHERVRKVYWGYAPNENLSNEELIRENYQGIRPAPGYPACPEHTEKATIWELLEVEKHTGMKLTESFAMWPGASVSGWYFSHPDSKYYAVAQIQRDQVEDYARRKGMSVTEVERWLAPNLGYDAD
17 -> 325 LVLDGGMGTMIQSYRLNEADFRGERFADWPCDLKGNNDLLVLSKPEVIAAIHNAYFEAGADIIETNTFNSTTIAMADYQMESLSAEINFAAAKLARACADEWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDGLVAAYRESTKALVEGGADLILIETVFDTLNAKAAVFAVKTEFEALGVELPIMISGTITDASGRTLSGQTTEAFYNSLRHAEALTFGLNCALGPDELRQYVQELSRIAECYVTAHPNAGLPNAFGEYDLDADTMAKQIREWAQAGFLNIVGGCCGTTPQHIAAMSRAV
748 -> 840 KMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVPAEKILRTAKEVNADLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.9 - methionine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
GO:0008705 - methionine synthase activity
GO:0031419 - cobalamin binding
biological_process GO:0044237 - cellular metabolic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009086 - methionine biosynthetic process
GO:0042558 - pteridine-containing compound metabolic process
GO:0032259 - methylation
GO:0035999 - tetrahydrofolate interconversion
GO:0050667 - homocysteine metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Cohn M., et al., 1953
[2] Kumar M., et al., 2013
[3] Kumar N., et al., 2011
[4] Kumar S., et al., 2015
[5] Marconi R., et al., 1991
[6] Old IG., et al., 1990
[7] Old IG., et al., 1993
[8] Taylor RT., et al., 1967
External database links:  
ECOCYC:
HOMOCYSMETB12-MONOMER
ECOLIWIKI:
b4019
INTERPRO:
IPR036594
INTERPRO:
IPR036589
INTERPRO:
IPR033706
INTERPRO:
IPR011822
INTERPRO:
IPR011005
INTERPRO:
IPR006158
INTERPRO:
IPR004223
INTERPRO:
IPR003759
INTERPRO:
IPR037010
INTERPRO:
IPR036724
INTERPRO:
IPR000489
INTERPRO:
IPR003726
MODBASE:
P13009
PDB:
6BM6
PDB:
6BM5
PDB:
6BDY
PDB:
3IVA
PDB:
3IV9
PDB:
3BUL
PDB:
1MSK
PDB:
1K98
PDB:
1K7Y
PDB:
1BMT
PFAM:
PF02965
PFAM:
PF02607
PFAM:
PF02574
PFAM:
PF00809
PFAM:
PF02310
PRIDE:
P13009
PROSITE:
PS51337
PROSITE:
PS51332
PROSITE:
PS50974
PROSITE:
PS50972
PROSITE:
PS50970
REFSEQ:
NP_418443
SMART:
SM01018
SMR:
P13009
UNIPROT:
P13009


Operon      
Name: metH         
Operon arrangement:
Transcription unit        Promoter
metH
metH


Transcriptional Regulation      
Display Regulation             
Activated by: MetR
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4839 4223784 forward nd [RS-EPT-CBR] [9]
  promoter TSS_4841 4227610 forward nd [RS-EPT-CBR] [9]
  promoter TSS_4842 4227613 forward nd [RS-EPT-CBR] [9]
  promoter TSS_4843 4227615 forward nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Cohn M., Cohen GN., Monod J., 1953, [The specific inhibiting effect of methionine in the formation of methionine-synthase by Escherichia coli]., C R Hebd Seances Acad Sci 236(7):746-8

 [2] Kumar M., Kozlowski PM., 2013, Can the local enzyme scaffold act as an H-donor for a Co(I)H bond formation? The curious case of methionine synthase-bound cob(I)alamin., J Inorg Biochem 126:26-34

 [3] Kumar N., Jaworska M., Lodowski P., Kumar M., Kozlowski PM., 2011, Electronic structure of cofactor-substrate reactant complex involved in the methyl transfer reaction catalyzed by cobalamin-dependent methionine synthase., J Phys Chem B 115(20):6722-31

 [4] Kumar S., Bhagabati P., Sachan R., Kaushik AC., Dwivedi VD., 2015, In Silico Analysis of Sequence-Structure-Function Relationship of the Escherichia coli Methionine Synthase., Interdiscip Sci 7(4):382-90

 [5] Marconi R., Wigboldus J., Weissbach H., Brot N., 1991, Transcriptional start and MetR binding sites on the Escherichia coli metH gene., Biochem Biophys Res Commun 175(3):1057-63

 [6] Old IG., Margarita D., Glass RE., Saint Girons I., 1990, Nucleotide sequence of the metH gene of Escherichia coli K-12 and comparison with that of Salmonella typhimurium LT2., Gene 87(1):15-21

 [7] Old IG., Saint Girons I., Richaud C., 1993, Physical mapping of the scattered methionine genes on the Escherichia coli chromosome., J Bacteriol 175(11):3689-91

 [8] Taylor RT., Weissbach H., 1967, N5-methyltetrahydrofolate-homocysteine transmethylase. Role of S-adenosylmethionine in vitamin B12-dependent methionine synthesis., J Biol Chem 242(7):1517-21

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB