RegulonDB RegulonDB 10.9: Gene Form
   

miaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mutL amiB miaA hfq CRP TSS_5016 TSS_5016 hfqp3 hfqp3 hfqp2 hfqp2 miaAp1 miaAp1 miaAp2 miaAp2 TSS_5013 TSS_5013 mutLp1 mutLp1 mutLp2 mutLp2

Gene      
Name: miaA    Texpresso search in the literature
Synonym(s): ECK4167, EG10595, b4171, trpX
Genome position(nucleotides): 4399252 --> 4400202 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.42
External database links:  
ASAP:
ABE-0013657
CGSC:
18160
ECHOBASE:
EB0590
ECOLIHUB:
miaA
OU-MICROARRAY:
b4171
STRING:
511145.b4171
COLOMBOS: miaA


Product      
Name: tRNA dimethylallyltransferase
Synonym(s): MiaA, TrpX, tRNA(i6A37) synthase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.065
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
19 -> 24 TASGKT
247 -> 252 RCVGYR
280 -> 287 KRQITWLR
46 -> 290 IYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLHTDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWE
166 -> 170 QRLSR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0052381 - tRNA dimethylallyltransferase activity
biological_process GO:0006400 - tRNA modification
GO:0008033 - tRNA processing
GO:0034605 - cellular response to heat
GO:1990497 - regulation of cytoplasmic translation in response to stress
Note(s): Note(s): ...[more].
Reference(s): [1] Bjornsson A., et al., 1993
External database links:  
ECOCYC:
EG10595-MONOMER
ECOLIWIKI:
b4171
INTERPRO:
IPR027417
INTERPRO:
IPR018022
INTERPRO:
IPR039657
PANTHER:
PTHR11088
PDB:
3FOZ
PDB:
2ZXU
PDB:
2ZM5
PFAM:
PF01715
PRIDE:
P16384
PRODB:
PRO_000023235
REFSEQ:
NP_418592
SMR:
P16384
UNIPROT:
P16384


Operon      
Name: nnr-tsaE-amiB-mutL-miaA-hfq-hflXKC         
Operon arrangement:
Transcription unit        Promoter
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
miaA-hfq-hflXKC
miaA-hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
tsaE-amiB-mutL-miaA-hfq-hflXKC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5013 4398332 forward nd [RS-EPT-CBR] [2]
  promoter TSS_5016 4400234 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bjornsson A., Isaksson LA., 1993, UGA codon context which spans three codons. Reversal by ms2i6A37 in tRNA, mutation in rpsD(S4) or streptomycin., J Mol Biol 232(4):1017-29

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB