RegulonDB RegulonDB 11.1: Gene Form
   

minE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

minD ycgI minE ymgJ terminator TSS_1502 TSS_1502 minEp3 minEp3 TSS_1501 TSS_1501

Gene      
Name: minE    Texpresso search in the literature
Synonym(s): ECK1162, EG10598, b1174, minB
Genome position(nucleotides): 1224279 <-- 1224545
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
 43.45
External database links:  
ASAP:
 ABE-0003935
CGSC:
 31317
ECHOBASE:
 EB0593
ECOLIHUB:
 minE
OU-MICROARRAY:
 b1174
STRING:
 511145.b1174
COLOMBOS: minE


Product      
Name: Z-ring positioning protein MinE
Synonym(s): MinB, MinE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 10.235
Isoelectric point: 4.889
Motif(s):
 
Type Positions Sequence Comment
1 -> 22 MALLDFFLSRKKNTANIAKERL suppresses the divsion block induced by MinCD
14 -> 82 TANIAKERLQIIVAERRRSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTLP
23 -> 81 QIIVAERRRSDAEPHYLPQLRKDILEVICKYVQIDPEMVTVQLEQKDGDISILELNVTL topological specificity domain; associated with the ability to suppress cell division inhibition at midcell but not at the cell poles
24 -> 24 I alternate sequence I → N: mutant protein characterised
25 -> 25 I alternate sequence I → R: mutant protein characterised

 
Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
  5 - cell processes --> 5.2 - cell cycle physiology
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0051302 - regulation of cell division
GO:0000918 - division septum site selection
GO:0032955 - regulation of division septum assembly
Note(s): Note(s): ...[more].
Evidence: [EXP-IDA-UNPURIFIED-PROTEIN-NH] Assay of unpurified protein expressed in its native host
[EXP-IGI] Inferred from genetic interaction
Reference(s): [1] Akerlund T., et al., 1993
[2] Bi E., et al., 1990
[3] Bonny M., et al., 2013
[4] Davie E., et al., 1984
[5] Denk J., et al., 2018
[6] Fu M., et al., 2020
[7] Huang KC., et al., 2003
[8] Jaffe A., et al., 1990
[9] Kohyama S., et al., 2020
[10] Kohyama S., et al., 2020
[11] Kretschmer S., et al., 2017
[12] Mizuuchi K., et al., 2018
[13] Mulder E., et al., 1991
[14] Norris V. 1992
[15] Park KT., et al., 2017
[16] Perez-Rodriguez MA., et al., 2018
[17] Pichoff S., et al., 1998
[18] Pichoff S., et al., 1997
[19] Ramm B., et al., 2018
[20] Raskin DM., et al., 1997
[21] Renner LD., et al., 2012
[22] Roos M., et al., 2001
[23] Schaumberg TH., et al., 1983
[24] Vecchiarelli AG., et al., 2016
[25] Vecchiarelli AG., et al., 2014
[26] Walsh JC., et al., 2015
[27] Wettmann L., et al., 2018
[28] Xiong L., et al., 2015
[29] Zhao CR., et al., 1995
[30] Zhou P., et al., 1997
[31] Zieske K., et al., 2013
[32] Zieske K., et al., 2014
[33] de Boer PA., et al., 1989
External database links:  
ALPHAFOLD:
 P0A734
DIP:
 DIP-35912N
ECOCYC:
 EG10598-MONOMER
ECOLIWIKI:
 b1174
INTERPRO:
 IPR005527
INTERPRO:
 IPR036707
MODBASE:
 P0A734
PANTHER:
 PTHR33404
PDB:
 1EV0
PDB:
 3R9J
PDB:
 3R9I
PFAM:
 PF03776
PRIDE:
 P0A734
PRODB:
 PRO_000023239
REFSEQ:
 NP_415692
SMR:
 P0A734
UNIPROT:
 P0A734


Operon      
Name: minCDE         
Operon arrangement:
Transcription unit        Promoter
minCDE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1501 1223746 forward nd [RS-EPT-CBR] [34]
  promoter minEp3 1224711 reverse nd [COMP-AINF] [35]
  promoter TSS_1502 1224778 reverse nd [RS-EPT-CBR] [34]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [COMP-AINF] Inferred computationally without human oversight


Reference(s)    

 [1] Akerlund T., Nordstrom K., Bernander R., 1993, Branched Escherichia coli cells., Mol Microbiol 10(4):849-58

 [2] Bi E., Lutkenhaus J., 1990, Interaction between the min locus and ftsZ., J Bacteriol 172(10):5610-6

 [3] Bonny M., Fischer-Friedrich E., Loose M., Schwille P., Kruse K., 2013, Membrane Binding of MinE Allows for a Comprehensive Description of Min-Protein Pattern Formation., PLoS Comput Biol 9(12):e1003347

 [4] Davie E., Sydnor K., Rothfield LI., 1984, Genetic basis of minicell formation in Escherichia coli K-12., J Bacteriol 158(3):1202-3

 [5] Denk J., Kretschmer S., Halatek J., Hartl C., Schwille P., Frey E., 2018, MinE conformational switching confers robustness on self-organized Min protein patterns., Proc Natl Acad Sci U S A 115(18):4553-4558

 [6] Fu M., Franquelim HG., Kretschmer S., Schwille P., 2020, Non-equilibrium large-scale membrane transformations driven by MinDE biochemical reaction cycles., Angew Chem Int Ed Engl

 [7] Huang KC., Meir Y., Wingreen NS., 2003, Dynamic structures in Escherichia coli: spontaneous formation of MinE rings and MinD polar zones., Proc Natl Acad Sci U S A 100(22):12724-8

 [8] Jaffe A., Boye E., D'Ari R., 1990, Rule governing the division pattern in Escherichia coli minB and wild-type filaments., J Bacteriol 172(6):3500-2

 [9] Kohyama S., Fujiwara K., Yoshinaga N., Doi N., 2020, Conformational equilibrium of MinE regulates the allowable concentration ranges of a protein wave for cell division., Nanoscale 12(22):11960-11970

 [10] Kohyama S., Fujiwara K., Yoshinaga N., Doi N., 2020, Self-organization Assay for Min Proteins of Escherichia coli in Micro-droplets Covered with Lipids., Bio Protoc 10(6):e3561

 [11] Kretschmer S., Zieske K., Schwille P., 2017, Large-scale modulation of reconstituted Min protein patterns and gradients by defined mutations in MinE's membrane targeting sequence., PLoS One 12(6):e0179582

 [12] Mizuuchi K., Vecchiarelli AG., 2018, Mechanistic insights of the Min oscillator via cell-free reconstitution and imaging., Phys Biol 15(3):031001

 [13] Mulder E., Woldringh CL., 1991, Autoradiographic analysis of diaminopimelic acid incorporation in filamentous cells of Escherichia coli: repression of peptidoglycan synthesis around the nucleoid., J Bacteriol 173(15):4751-6

 [14] Norris V., 1992, Phospholipid domains determine the spatial organization of the Escherichia coli cell cycle: the membrane tectonics model., J Theor Biol 154(1):91-107

 [15] Park KT., Villar MT., Artigues A., Lutkenhaus J., 2017, MinE conformational dynamics regulate membrane binding, MinD interaction, and Min oscillation., Proc Natl Acad Sci U S A 114(29):7497-7504

 [16] Perez-Rodriguez MA., Rodriguez-Luna IC., Carreno-Lopez R., Lara-Ramirez EE., Rodriguez-Perez MA., Guo X., 2018, The sequences of MinE responsible for its subcellular localization analyzed by competitive binding method in Escherichia coli., Int Microbiol 21(1-2):15-22

 [17] Pichoff S., Alibaud L., Guedant A., Castanie MP., Bouche JP., 1998, An Escherichia coli gene (yaeO) suppresses temperature-sensitive mutations in essential genes by modulating Rho-dependent transcription termination., Mol Microbiol 29(3):859-69

 [18] Pichoff S., Vollrath B., Bouche JP., 1997, MinCD-independent inhibition of cell division by a protein that fuses MalE to the topological specificity factor MinE., J Bacteriol 179(14):4616-9

 [19] Ramm B., Glock P., Schwille P., 2018, In Vitro Reconstitution of Self-Organizing Protein Patterns on Supported Lipid Bilayers., J Vis Exp (137)

 [20] Raskin DM., de Boer PA., 1997, The MinE ring: an FtsZ-independent cell structure required for selection of the correct division site in E. coli., Cell 91(5):685-94

 [21] Renner LD., Weibel DB., 2012, MinD and MinE interact with anionic phospholipids and regulate division plane formation in Escherichia coli., J Biol Chem 287(46):38835-44

 [22] Roos M., van Geel AB., Aarsman ME., Veuskens JT., Woldringh CL., Nanninga N., 2001, The replicated ftsQAZ and minB chromosomal regions of Escherichia coli segregate on average in line with nucleoid movement., Mol Microbiol 39(3):633-40

 [23] Schaumberg TH., Kuempel PL., 1983, Genetic mapping of the minB locus in Escherichia coli K-12., J Bacteriol 153(2):1063-5

 [24] Vecchiarelli AG., Li M., Mizuuchi M., Hwang LC., Seol Y., Neuman KC., Mizuuchi K., 2016, Membrane-bound MinDE complex acts as a toggle switch that drives Min oscillation coupled to cytoplasmic depletion of MinD., Proc Natl Acad Sci U S A 113(11):E1479-88

 [25] Vecchiarelli AG., Li M., Mizuuchi M., Mizuuchi K., 2014, Differential affinities of MinD and MinE to anionic phospholipid influence Min patterning dynamics in vitro., Mol Microbiol 93(3):453-63

 [26] Walsh JC., Angstmann CN., Duggin IG., Curmi PM., 2015, Molecular Interactions of the Min Protein System Reproduce Spatiotemporal Patterning in Growing and Dividing Escherichia coli Cells., PLoS One 10(5):e0128148

 [27] Wettmann L., Bonny M., Kruse K., 2018, Effects of geometry and topography on Min-protein dynamics., PLoS One 13(8):e0203050

 [28] Xiong L., Lan G., 2015, An Optimal Free Energy Dissipation Strategy of the MinCDE Oscillator in Regulating Symmetric Bacterial Cell Division., PLoS Comput Biol 11(8):e1004351

 [29] Zhao CR., de Boer PA., Rothfield LI., 1995, Proper placement of the Escherichia coli division site requires two functions that are associated with different domains of the MinE protein., Proc Natl Acad Sci U S A 92(10):4313-7

 [30] Zhou P., Bogan JA., Welch K., Pickett SR., Wang HJ., Zaritsky A., Helmstetter CE., 1997, Gene transcription and chromosome replication in Escherichia coli., J Bacteriol 179(1):163-9

 [31] Zieske K., Schwille P., 2013, Reconstitution of pole-to-pole oscillations of min proteins in microengineered polydimethylsiloxane compartments., Angew Chem Int Ed Engl 52(1):459-62

 [32] Zieske K., Schwille P., 2014, Reconstitution of self-organizing protein gradients as spatial cues in cell-free systems., Elife 3

 [33] de Boer PA., Crossley RE., Rothfield LI., 1989, A division inhibitor and a topological specificity factor coded for by the minicell locus determine proper placement of the division septum in E. coli., Cell 56(4):641-9

 [34] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [35] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

RegulonDB