RegulonDB RegulonDB 10.9: Gene Form
   

murE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murE murF mraY ftsI ftsI-int TSS_168 TSS_168 TSS_167 TSS_167 TSS_166 TSS_166 TSS_165 TSS_165 TSS_164 TSS_164 TSS_163 (cluster) TSS_163 (cluster) TSS_162 TSS_162 TSS_161 (cluster) TSS_161 (cluster) TSS_160 TSS_160 TSS_159 TSS_159

Gene      
Name: murE    Texpresso search in the literature
Synonym(s): ECK0086, EG10621, b0085
Genome position(nucleotides): 93166 --> 94653 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.59
External database links:  
ASAP:
ABE-0000311
CGSC:
475
ECHOBASE:
EB0616
ECOLIHUB:
murE
OU-MICROARRAY:
b0085
STRING:
511145.b0085
COLOMBOS: murE


Product      
Name: UDP-N-acetylmuramoyl-L-alanyl-D-glutamate—2,6-diaminopimelate ligase
Synonym(s): MurE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 53.344
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
116 -> 122 GTNGKTT
414 -> 417 DNPR
339 -> 425 VCGRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEEPRAII
495 -> 495 A
2 -> 495 ADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGVAAIIAEAKDEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHEPSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGEISAVMGTVGNGLLGKVIPTENTTGSAVDVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSEHHCGQAIINADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNYHDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKENDVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0016881 - acid-amino acid ligase activity
GO:0008765 - UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligase activity
GO:0000287 - magnesium ion binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0009058 - biosynthetic process
GO:0009252 - peptidoglycan biosynthetic process
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Maruyama IN., et al., 1988
[2] Michaud C., et al., 1990
[3] Tao JS., et al., 1989
External database links:  
DIP:
DIP-10280N
ECOCYC:
UDP-NACMURALGLDAPLIG-MONOMER
ECOLIWIKI:
b0085
INTERPRO:
IPR005761
INTERPRO:
IPR036615
INTERPRO:
IPR036565
INTERPRO:
IPR035911
INTERPRO:
IPR013221
INTERPRO:
IPR004101
INTERPRO:
IPR000713
MODBASE:
P22188
PDB:
1E8C
PFAM:
PF02875
PFAM:
PF01225
PFAM:
PF08245
PRIDE:
P22188
PRODB:
PRO_000023316
REFSEQ:
NP_414627
SMR:
P22188
UNIPROT:
P22188


Operon      
Name: mraZ-rsmH-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC         
Operon arrangement:
Transcription unit        Promoter
mraZW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
mraW-ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsLI-murEF-mraY-murD-ftsW-murGC-ddlB-ftsQAZ-lpxC
ftsQ
ftsQAZ
ftsQAZ
ftsAZ
ftsZ
ftsZ
ftsZ
lpxC
lpxC


Transcriptional Regulation      
Display Regulation             
Repressed by: MraZ, LexA, PdhR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_159 92485 forward nd [RS-EPT-CBR] [4]
  promoter TSS_160 94608 forward nd [RS-EPT-CBR] [4]
  promoter TSS_161 (cluster) 94681 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_162 96153 forward nd [RS-EPT-CBR] [4]
  promoter TSS_163 (cluster) 96971 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_164 96982 forward nd [RS-EPT-CBR] [4]
  promoter TSS_165 96984 forward nd [RS-EPT-CBR] [4]
  promoter TSS_166 96988 forward nd [RS-EPT-CBR] [4]
  promoter TSS_167 96993 forward nd [RS-EPT-CBR] [4]
  promoter TSS_168 96997 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Maruyama IN., Yamamoto AH., Hirota Y., 1988, Determination of gene products and coding regions from the murE-murF region of Escherichia coli., J Bacteriol 170(8):3786-8

 [2] Michaud C., Parquet C., Flouret B., Blanot D., van Heijenoort J., 1990, Revised interpretation of the sequence containing the murE gene encoding the UDP-N-acetylmuramyl-tripeptide synthetase of Escherichia coli., Biochem J 269(1):277-8

 [3] Tao JS., Ishiguro EE., 1989, Nucleotide sequence of the murE gene of Escherichia coli., Can J Microbiol 35(11):1051-4

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB