RegulonDB RegulonDB 10.9: Gene Form
   

umpH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

asnB nagC umpH TSS_797 TSS_797 TSS_796 TSS_796 TSS_795 TSS_795 TSS_794 TSS_794 TSS_793 TSS_793 TSS_792 TSS_792 umpHp umpHp asnBp asnBp

Gene      
Name: umpH    Texpresso search in the literature
Synonym(s): ECK0663, EG10634, b0675, nagD
Genome position(nucleotides): 699574 <-- 700326 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.99
External database links:  
ASAP:
ABE-0002296
CGSC:
36240
ECHOBASE:
EB0628
ECOLIHUB:
nagD
OU-MICROARRAY:
b0675
STRING:
511145.b0675
COLOMBOS: umpH


Product      
Name: UMP phosphatase
Synonym(s): NagD, UmpH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.163
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
42 -> 43 TN
97 -> 97 H
174 -> 246 VGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLSGVSSLDDIDSMPFRPSWIYPSVAE
6 -> 105 VICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYPSQTGQDLANRFATAGVDVPDSVFYTSAMATADFLRRQEGKKAYVVGEGALIHELYKAGFT
202 -> 205 NLRT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.4 - pyrimidine ribonucleotide biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008253 - 5'-nucleotidase activity
GO:0016791 - phosphatase activity
GO:0000287 - magnesium ion binding
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016311 - dephosphorylation
GO:0046050 - UMP catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-6861N
ECOCYC:
EG10634-MONOMER
ECOLIWIKI:
b0675
INTERPRO:
IPR036412
INTERPRO:
IPR006357
INTERPRO:
IPR023214
MODBASE:
P0AF24
PDB:
2C4N
PFAM:
PF13242
PFAM:
PF13344
PRIDE:
P0AF24
PRODB:
PRO_000023339
REFSEQ:
NP_415201
SMR:
P0AF24
SWISSMODEL:
P0AF24
UNIPROT:
P0AF24


Operon      
Name: nagBAC-umpH         
Operon arrangement:
Transcription unit        Promoter
umpH
nagC
nagC
nagA
nagBACD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_792 700355 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_793 701039 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_794 701340 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_795 701360 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_796 701362 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_797 701364 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB