RegulonDB RegulonDB 10.10: Gene Form
   

sfsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: sfsB    Texpresso search in the literature
Synonym(s): ECK3177, EG10656, b3188, nlp, sfs7
Genome position(nucleotides): 3334909 --> 3335187 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.18
External database links:  
ASAP:
ABE-0010477
CGSC:
35693
ECHOBASE:
EB0650
ECOLIHUB:
sfsB
OU-MICROARRAY:
b3188
STRING:
511145.b3188
COLOMBOS: sfsB


Product      
Name: putative transcriptional regulator SfsB
Synonym(s): Nlp, SfsB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.495
Isoelectric point: 10.54
Motif(s):
 
Type Positions Sequence
50 -> 69 EMIIAKALGTDPWVIWPSRY
7 -> 81 DWHPADIIAGLRKKGTSMAAESRRNGLSSSTLANALSRPWPKGEMIIAKALGTDPWVIWPSRYHDPQTHEFIDRT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006351 - transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Choi YL., et al., 1989
External database links:  
ECOCYC:
EG10656-MONOMER
ECOLIWIKI:
b3188
INTERPRO:
IPR010982
INTERPRO:
IPR038722
MODBASE:
P0ACH1
PFAM:
PF13693
PRIDE:
P0ACH1
PRODB:
PRO_000023942
REFSEQ:
NP_417655
SMR:
P0ACH1
SWISSMODEL:
P0ACH1
UNIPROT:
P0ACH1


Operon      
Name: sfsB         
Operon arrangement:
Transcription unit        Promoter
sfsB


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB-BglJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3498 3334281 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3499 3334302 forward nd [RS-EPT-CBR] [2]
  promoter sfsBp2 3334796 forward nd [ICWHO] [3]
  promoter sfsBp3 3334855 forward nd [ICWHO] [3]



RegulonDB