RegulonDB RegulonDB 11.0: Gene Form
   

nusB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thiL ribE nusB pgpA TSS_536 TSS_536 TSS_535 TSS_535

Gene      
Name: nusB    Texpresso search in the literature
Synonym(s): ECK0410, EG10666, b0416, groNB, ssaD, ssyB
Genome position(nucleotides): 435137 --> 435556
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.81
External database links:  
ASAP:
ABE-0001447
CGSC:
440
ECHOBASE:
EB0660
ECOLIHUB:
nusB
OU-MICROARRAY:
b0416
STRING:
511145.b0416
COLOMBOS: nusB


Product      
Name: transcription antitermination protein NusB
Synonym(s): NusB, SsaD, SsyB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.689
Isoelectric point: 7.351
Motif(s):
 
Type Positions Sequence Comment
8 -> 131 RARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEAIELAKSFGAEDSHKFVNGVLDKAA
18 -> 18 Y UniProt: In nusB5; abolishes antitermination..
59 -> 59 T UniProt: In Ref. 1..

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0008023 - transcription elongation factor complex
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0003723 - RNA binding
biological_process GO:0006353 - DNA-templated transcription, termination
GO:0006355 - regulation of transcription, DNA-templated
GO:0031564 - transcription antitermination
GO:0042254 - ribosome biogenesis
GO:0032784 - regulation of DNA-templated transcription, elongation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Kuroki K., et al., 1982
[2] Strauch M., et al., 1981
External database links:  
ALPHAFOLD:
P0A780
DIP:
DIP-48254N
ECOCYC:
EG10666-MONOMER
ECOLIWIKI:
b0416
INTERPRO:
IPR011605
INTERPRO:
IPR035926
INTERPRO:
IPR006027
MODBASE:
P0A780
PANTHER:
PTHR11078
PDB:
3D3B
PDB:
3D3C
PDB:
3IMQ
PDB:
5MS0
PDB:
6TQN
PDB:
1EY1
PDB:
6TQO
PFAM:
PF01029
PRIDE:
P0A780
PRODB:
PRO_000023446
REFSEQ:
NP_414950
SMR:
P0A780
UNIPROT:
P0A780


Operon      
Name: nrdR-ribDE-nusB-thiL-pgpA         
Operon arrangement:
Transcription unit        Promoter
nrdR-ribDE-nusB-thiL-pgpA
ribE-nusB-thiL-pgpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_535 434974 forward nd [RS-EPT-CBR] [3]
  promoter TSS_536 436581 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kuroki K., Ishii S., Kano Y., Miyashita T., Nishi K., Imamoto F., 1982, Involvement of the nusB gene products in transcription of Escherichia coli tryptophan operon in vitro., Mol Gen Genet 185(2):369-71

 [2] Strauch M., Friedman DI., 1981, Identification of the nusB gene product of Escherichia coli., Mol Gen Genet 182(3):498-501

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB