RegulonDB RegulonDB 10.9: Gene Form
   

oppA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

oppA insH21 oppB Fur GcvB terminator anti-terminator anti-anti-terminator terminator TSS_1660 TSS_1660 oppBp oppBp TSS_1659 TSS_1659 TSS_1658 TSS_1658 TSS_1657 TSS_1657 TSS_1656 TSS_1656 TSS_1655 TSS_1655 TSS_1654 TSS_1654 TSS_1653 TSS_1653 TSS_1652 (cluster) TSS_1652 (cluster) TSS_1651 TSS_1651 TSS_1650 TSS_1650 TSS_1649 TSS_1649 TSS_1648 TSS_1648 TSS_1647 (cluster) TSS_1647 (cluster) TSS_1646 TSS_1646 TSS_1645 (cluster) TSS_1645 (cluster) TSS_1644 TSS_1644 TSS_1643 TSS_1643 TSS_1642 TSS_1642 TSS_1641 TSS_1641 TSS_1640 (cluster) TSS_1640 (cluster) TSS_1639 (cluster) TSS_1639 (cluster) TSS_1638 (cluster) TSS_1638 (cluster) TSS_1637 (cluster) TSS_1637 (cluster) TSS_1636 (cluster) TSS_1636 (cluster) TSS_1635 (cluster) TSS_1635 (cluster) TSS_1634 TSS_1634 TSS_1633 TSS_1633 TSS_1632 TSS_1632 TSS_1631 (cluster) TSS_1631 (cluster) oppAp oppAp TSS_1630 (cluster) TSS_1630 (cluster) TSS_1629 TSS_1629 TSS_1628 (cluster) TSS_1628 (cluster) TSS_1627 TSS_1627 TSS_1626 (cluster) TSS_1626 (cluster) TSS_1625 TSS_1625 TSS_1624 (cluster) TSS_1624 (cluster) TSS_1623 TSS_1623

Gene      
Name: oppA    Texpresso search in the literature
Synonym(s): ECK1237, EG10674, b1243
Genome position(nucleotides): 1301182 --> 1302813 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.73
External database links:  
ASAP:
ABE-0004172
CGSC:
18094
ECHOBASE:
EB0668
ECOLIHUB:
oppA
OU-MICROARRAY:
b1243
STRING:
511145.b1243
COLOMBOS: oppA


Product      
Name: oligopeptide ABC transporter periplasmic binding protein
Synonym(s): OppA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 60.899
Isoelectric point: 6.453
Motif(s):
 
Type Positions Sequence
314 -> 315 RV
82 -> 463 PAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMN
271 -> 271 N
27 -> 543 ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
1 -> 26 MTNITKRSLVAAGVLAALMAGNVALA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:1900750 - oligopeptide binding
GO:1904680 - peptide transmembrane transporter activity
biological_process GO:0009408 - response to heat
GO:0015031 - protein transport
GO:0006857 - oligopeptide transport
GO:0015833 - peptide transport
GO:0055085 - transmembrane transport
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Reference(s): [1] Acosta MB., et al., 2000
[2] Igarashi K., et al., 1997
[3] Kashiwagi K., et al., 1992
[4] Maqbool A., et al., 2011
[5] Nakamatsu EH., et al., 2007
[6] Yoshida M., et al., 1999
External database links:  
DIP:
DIP-10405N
ECOCYC:
OPPA-MONOMER
ECOLIWIKI:
b1243
INTERPRO:
IPR030678
INTERPRO:
IPR039424
INTERPRO:
IPR023765
INTERPRO:
IPR000914
MODBASE:
P23843
PANTHER:
PTHR30290
PDB:
3TCF
PDB:
3TCH
PDB:
3TCG
PFAM:
PF00496
PRIDE:
P23843
PRODB:
PRO_000023461
PROSITE:
PS01040
REFSEQ:
NP_415759
SMR:
P23843
SWISSMODEL:
P23843
UNIPROT:
P23843


Operon      
Name: oppABCDF         
Operon arrangement:
Transcription unit        Promoter
oppABCDF
oppBCDF


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, Lrp, ArcA, ModE


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1623 1300978 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1624 (cluster) 1301011 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1625 1301043 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1626 (cluster) 1301047 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1627 1301061 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1628 (cluster) 1301063 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1629 1301072 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1630 (cluster) 1301075 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1631 (cluster) 1301130 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1632 1301156 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1633 1301325 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1634 1301421 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1635 (cluster) 1301440 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1636 (cluster) 1301445 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1637 (cluster) 1301448 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1638 (cluster) 1301452 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1639 (cluster) 1301462 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1640 (cluster) 1301471 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1641 1301475 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1642 1301479 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1643 1301484 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1644 1301505 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1645 (cluster) 1301513 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1646 1301585 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1647 (cluster) 1301592 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1648 1301596 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1649 1301629 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1650 1301632 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1651 1301651 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1652 (cluster) 1301927 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1653 1301955 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1654 1301979 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1655 1302037 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1656 1302088 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1657 1302221 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1658 1302237 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1659 1302457 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1660 1303510 forward nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Acosta MB., Ferreira RC., Padilla G., Ferreira LC., Costa SO., 2000, Altered expression of oligopeptide-binding protein (OppA) and aminoglycoside resistance in laboratory and clinical Escherichia coli strains., J Med Microbiol 49(5):409-13

 [2] Igarashi K., Saisho T., Yuguchi M., Kashiwagi K., 1997, Molecular mechanism of polyamine stimulation of the synthesis of oligopeptide-binding protein., J Biol Chem 272(7):4058-64

 [3] Kashiwagi K., Miyaji A., Ikeda S., Tobe T., Sasakawa C., Igarashi K., 1992, Increase of sensitivity to aminoglycoside antibiotics by polyamine-induced protein (oligopeptide-binding protein) in Escherichia coli., J Bacteriol 174(13):4331-7

 [4] Maqbool A., Levdikov VM., Blagova EV., Herve M., Horler RS., Wilkinson AJ., Thomas GH., 2011, Compensating stereochemical changes allow murein tripeptide to be accommodated in a conventional peptide-binding protein., J Biol Chem 286(36):31512-21

 [5] Nakamatsu EH., Fujihira E., Ferreira RC., Balan A., Costa SO., Ferreira LC., 2007, Oligopeptide uptake and aminoglycoside resistance in Escherichia coli K12., FEMS Microbiol Lett 269(2):229-33

 [6] Yoshida M., Meksuriyen D., Kashiwagi K., Kawai G., Igarashi K., 1999, Polyamine stimulation of the synthesis of oligopeptide-binding protein (OppA). Involvement of a structural change of the Shine-Dalgarno sequence and the initiation codon aug in oppa mRNA., J Biol Chem 274(32):22723-8

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB