RegulonDB RegulonDB 10.9: Gene Form
   

pabA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

argD fic pabA yhfG ArgR ArgR PhoP pabAp1 pabAp1 argDp argDp TSS_3962 TSS_3962

Gene      
Name: pabA    Texpresso search in the literature
Synonym(s): ECK3348, EG10682, b3360
Genome position(nucleotides): 3490266 <-- 3490829 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.37
External database links:  
ASAP:
ABE-0010983
CGSC:
429
ECHOBASE:
EB0676
ECOLIHUB:
pabA
OU-MICROARRAY:
b3360
STRING:
511145.b3360
COLOMBOS: pabA


Product      
Name: aminodeoxychorismate synthase subunit 2
Synonym(s): PabA, aminodeoxychorismate synthase component 2, para-aminobenzoate synthase glutamine amidotransferase component II
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.772
Isoelectric point: 6.59
Motif(s):
 
Type Positions Sequence
1 -> 187 MILLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAGISLDVIRHYAGRLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLANPLTVTRYHSLVVEPDSLPACFDVTAWSETREIMGIRHRQWDLEGVQFHPESILSEQGHQLLANFLHR
79 -> 79 C
168 -> 168 H
3 -> 186 LLIDNYDSFTWNLYQYFCELGADVLVKRNDALTLADIDALKPQKIVISPGPCTPDEAGISLDVIRHYAGRLPILGVCLGHQAMAQAFGGKVVRAAKVMHGKTSPITHNGEGVFRGLANPLTVTRYHSLVVEPDSLPACFDVTAWSETREIMGIRHRQWDLEGVQFHPESILSEQGHQLLANFLH
170 -> 170 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0046820 - 4-amino-4-deoxychorismate synthase activity
biological_process GO:0000162 - tryptophan biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0046656 - folic acid biosynthetic process
GO:0046654 - tetrahydrofolate biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10433N
ECOCYC:
PABASYN-COMPII-MONOMER
ECOLIWIKI:
b3360
INTERPRO:
IPR006221
INTERPRO:
IPR029062
INTERPRO:
IPR017926
MODBASE:
P00903
PFAM:
PF00117
PRIDE:
P00903
PRODB:
PRO_000023484
PROSITE:
PS51273
REFSEQ:
NP_417819
SMR:
P00903
SWISSMODEL:
P00903
UNIPROT:
P00903


Operon      
Name: yhfG-fic-pabA         
Operon arrangement:
Transcription unit        Promoter
pabA
yhfG-fic-pabA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3962 3490187 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB