RegulonDB RegulonDB 10.9: Gene Form
   

pal gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tolB cpoB pal TSS_896 TSS_896 TSS_895 TSS_895 TSS_894 TSS_894 TSS_893 TSS_893 TSS_892 TSS_892 TSS_891 TSS_891

Gene      
Name: pal    Texpresso search in the literature
Synonym(s): ECK0730, EG10684, b0741, excC
Genome position(nucleotides): 779067 --> 779588 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.34
Reference(s): [1] Chen R., et al., 1987
External database links:  
ASAP:
ABE-0002521
CGSC:
35129
ECHOBASE:
EB0678
ECOLIHUB:
pal
OU-MICROARRAY:
b0741
STRING:
511145.b0741
COLOMBOS: pal


Product      
Name: peptidoglycan-associated outer membrane lipoprotein Pal
Synonym(s): ExcC, Pal, Pal - outer membrane lipoprotein of the Tol-Pal system, protein 21K
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 18.824
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
116 -> 143 EYNISLGERRANAVKMYLQGKGVSADQI
145 -> 174 IVSYGKEKPAVLGHDEAAYSKNRRAVLVY
147 -> 150 SYGK
60 -> 173 LQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY
110 -> 151 DERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
GO:0031246 - intrinsic component of periplasmic side of cell outer membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0090529 - cell septum assembly
Note(s): Note(s): ...[more].
Reference(s): [2] Cascales E., et al., 2004
[3] McBroom AJ., et al., 2006
External database links:  
DIP:
DIP-51001N
ECOCYC:
EG10684-MONOMER
ECOLIWIKI:
b0741
INTERPRO:
IPR014169
INTERPRO:
IPR006690
INTERPRO:
IPR006665
INTERPRO:
IPR036737
INTERPRO:
IPR039001
INTERPRO:
IPR006664
MINT:
P0A912
MODBASE:
P0A912
PDB:
2W8B
PDB:
2HQS
PDB:
1OAP
PFAM:
PF00691
PRIDE:
P0A912
PRINTS:
PR01021
PRODB:
PRO_000023487
PROSITE:
PS01068
PROSITE:
PS51123
PROSITE:
PS51257
REFSEQ:
NP_415269
SMR:
P0A912
UNIPROT:
P0A912


Operon      
Name: tolB-pal-cpoB         
Operon arrangement:
Transcription unit        Promoter
tolB-pal-ybgF


Regulation by small RNA    
  Display Regulation
small RNA micA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_891 777769 forward nd [RS-EPT-CBR] [4]
  promoter TSS_892 778129 forward nd [RS-EPT-CBR] [4]
  promoter TSS_893 778824 forward nd [RS-EPT-CBR] [4]
  promoter TSS_894 778979 forward nd [RS-EPT-CBR] [4]
  promoter TSS_895 779058 forward nd [RS-EPT-CBR] [4]
  promoter TSS_896 779365 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chen R., Henning U., 1987, Nucleotide sequence of the gene for the peptidoglycan-associated lipoprotein of Escherichia coli K12., Eur J Biochem 163(1):73-7

 [2] Cascales E., Lloubes R., 2004, Deletion analyses of the peptidoglycan-associated lipoprotein Pal reveals three independent binding sequences including a TolA box., Mol Microbiol 51(3):873-85

 [3] McBroom AJ., Johnson AP., Vemulapalli S., Kuehn MJ., 2006, Outer membrane vesicle production by Escherichia coli is independent of membrane instability., J Bacteriol 188(15):5385-92

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB